DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wor and CG2678

Sequence 1:NP_476601.1 Gene:wor FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_649750.1 Gene:CG2678 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster

Alignment Length:323 Identity:76/324 (23%)
Similarity:117/324 (36%) Gaps:88/324 (27%)


  Fly   251 ENQDINQLKIKSSNDLYYQCQQCNKCYATYAGLVKHQQTHAYESTEYKIIRSQPGGSGAIVDQTE 315
            :||.||| |::..:|.....||..|.......| ..:||...:..|..|  ..|..|..:..:..
  Fly   108 KNQIINQ-KMQLKSDRQQDTQQMTKTQKPDDDL-SQKQTLQAKLQEGNI--DGPPESFTLHPRKR 168

  Fly   316 FC-TDQASALIQAANVASAQSMQKPVGVPRYHCQDCGKSYSTYSGLSKHQQFHCPSAEGNQVKKV 379
            .| |::.:.:|......|.:.:....|.  |:|..|.|.:.:.:.|..|....|     |:    
  Fly   169 TCRTEEQADMIPKEATRSTKMICDADGY--YNCPHCSKRFCSQTQLRTHITDLC-----NR---- 222

  Fly   380 FSCKNCDKTYVSLGALKMHIRTH-TLPC-KCPICGKAFSRPWLLQGHIRTHTGEKPFSCQHCNRA 442
              |..|.:||:....||.|:|.| :.|. ||..|.|||.|...|:.|:|||..:.|.||..|:..
  Fly   223 --CPYCPRTYMQKSNLKRHLRNHLSKPAHKCFHCSKAFMRKDHLKRHLRTHDSDGPLSCSQCSAV 285

  Fly   443 FADRSNLRAHMQTH-----------------------SDVK--------------------KYSC 464
            |.:...|..|.:.|                       .|:|                    |..|
  Fly   286 FIEHVQLEIHRREHKQRPGSSKSESTKDPDSDDSDQAQDLKPKWTKNTFNGTCSIPPMLKPKPIC 350

  Fly   465 PTCTKSFSRMSLLAKHLQSG-----------CQTEQSGGPSGSGGGFDQQQLQQHLQVYEEGH 516
            ..|.|.||.:..|.:|:.:.           |.              ::.:.::||:.:|.||
  Fly   351 DICQKKFSSVYALKRHMLTHNRQHHLKKCTYCS--------------EEFKTEKHLKRHERGH 399

Known Domains:


GeneSequenceDomainRegion External IDIdentity
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368 6/20 (30%)
C2H2 Zn finger 317..334 CDD:275368 4/18 (22%)
zf-C2H2 345..367 CDD:278523 6/22 (27%)
C2H2 Zn finger 347..367 CDD:275368 5/20 (25%)
PHA00732 379..>417 CDD:177300 16/40 (40%)
C2H2 Zn finger 382..402 CDD:275368 8/20 (40%)
zf-C2H2_8 405..482 CDD:292531 31/121 (26%)
zf-C2H2 406..428 CDD:278523 11/23 (48%)
C2H2 Zn finger 408..428 CDD:275368 10/20 (50%)
zf-H2C2_2 421..444 CDD:290200 10/23 (43%)
zf-C2H2 434..456 CDD:278523 6/22 (27%)
C2H2 Zn finger 436..456 CDD:275368 5/20 (25%)
zf-H2C2_2 448..473 CDD:290200 11/68 (16%)
C2H2 Zn finger 464..481 CDD:275368 7/17 (41%)
CG2678NP_649750.1 zf-AD 8..85 CDD:214871
COG5048 220..>284 CDD:227381 28/75 (37%)
C2H2 Zn finger 223..243 CDD:275368 8/20 (40%)
zf-C2H2 249..271 CDD:278523 11/22 (50%)
C2H2 Zn finger 251..271 CDD:275368 10/20 (50%)
C2H2 Zn finger 279..299 CDD:275368 5/20 (25%)
C2H2 Zn finger 350..370 CDD:275368 7/20 (35%)
C2H2 Zn finger 379..399 CDD:275368 5/34 (15%)
C2H2 Zn finger 406..427 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24409
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.