| Sequence 1: | NP_476601.1 | Gene: | wor / 34906 | FlyBaseID: | FBgn0001983 | Length: | 548 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_649750.1 | Gene: | CG2678 / 40937 | FlyBaseID: | FBgn0014931 | Length: | 434 | Species: | Drosophila melanogaster |
| Alignment Length: | 323 | Identity: | 76/323 - (23%) |
|---|---|---|---|
| Similarity: | 117/323 - (36%) | Gaps: | 88/323 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 251 ENQDINQLKIKSSNDLYYQCQQCNKCYATYAGLVKHQQTHAYESTEYKIIRSQPGGSGAIVDQTE 315
Fly 316 FC-TDQASALIQAANVASAQSMQKPVGVPRYHCQDCGKSYSTYSGLSKHQQFHCPSAEGNQVKKV 379
Fly 380 FSCKNCDKTYVSLGALKMHIRTH-TLPC-KCPICGKAFSRPWLLQGHIRTHTGEKPFSCQHCNRA 442
Fly 443 FADRSNLRAHMQTH-----------------------SDVK--------------------KYSC 464
Fly 465 PTCTKSFSRMSLLAKHLQSG-----------CQTEQSGGPSGSGGGFDQQQLQQHLQVYEEGH 516 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| wor | NP_476601.1 | C2H2 Zn finger | 270..290 | CDD:275368 | 5/19 (26%) |
| C2H2 Zn finger | 317..334 | CDD:275368 | 4/17 (24%) | ||
| zf-C2H2 | 345..367 | CDD:278523 | 6/21 (29%) | ||
| C2H2 Zn finger | 347..367 | CDD:275368 | 5/19 (26%) | ||
| PHA00732 | 379..>417 | CDD:177300 | 16/39 (41%) | ||
| C2H2 Zn finger | 382..402 | CDD:275368 | 8/19 (42%) | ||
| zf-C2H2_8 | 405..482 | CDD:292531 | 31/120 (26%) | ||
| zf-C2H2 | 406..428 | CDD:278523 | 10/22 (45%) | ||
| C2H2 Zn finger | 408..428 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 421..444 | CDD:290200 | 9/22 (41%) | ||
| zf-C2H2 | 434..456 | CDD:278523 | 6/21 (29%) | ||
| C2H2 Zn finger | 436..456 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 448..473 | CDD:290200 | 10/67 (15%) | ||
| C2H2 Zn finger | 464..481 | CDD:275368 | 6/16 (38%) | ||
| CG2678 | NP_649750.1 | zf-AD | 8..85 | CDD:214871 | |
| COG5048 | 220..>284 | CDD:227381 | 28/74 (38%) | ||
| C2H2 Zn finger | 223..243 | CDD:275368 | 8/19 (42%) | ||
| zf-C2H2 | 249..271 | CDD:278523 | 10/21 (48%) | ||
| C2H2 Zn finger | 251..271 | CDD:275368 | 9/19 (47%) | ||
| C2H2 Zn finger | 279..299 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 350..370 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 379..399 | CDD:275368 | 4/33 (12%) | ||
| C2H2 Zn finger | 406..427 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR24409 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||