DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wor and CG30431

Sequence 1:NP_476601.1 Gene:wor FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_610211.1 Gene:CG30431 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster

Alignment Length:413 Identity:93/414 (22%)
Similarity:155/414 (37%) Gaps:84/414 (20%)


  Fly    64 LRRRFDAAMNQTK----EQLAR---RIWEETREIARAFPDVFTREEIAKSLARLGYGEFELPPEE 121
            |||..||...|.:    ||:.|   ..|:.|..:.    |....:::.:.|.| ..|..|.|  .
  Fly    61 LRRLHDARDFQRRCEHSEQVLRMRHEHWKHTVAVG----DALALDDVLECLER-EVGSLEGP--M 118

  Fly   122 EVMEPEPEPEQHL-PLRYTRDASPTIIKAEPSDEEQFPL---RNYNNNLLKSIAEYEDCMKMQNI 182
            .|.....:|..|: ||..|.|......:.....|...|.   .:.::..|.:.....:..::..:
  Fly   119 SVPLQASKPVAHVAPLMETVDFESLDFQDSSHSEHDIPSYWESSVDSGSLNTPHHQPETAELFAV 183

  Fly   183 KEEIPPIPSPQLFYPPPTPLAEPEDLSVTQRRVLSENMNLQNVARALLSMQHMAPQHAPPPIDME 247
            :...||..|.:   |.|....:|:     .||......|::...|......|....|..|..:.:
  Fly   184 EPPTPPESSEE---PAPDAAEKPK-----MRRARPRQDNVKPKERKASGAVHPRSLHPCPECEKK 240

  Fly   248 EDQENQ-DINQLKIKSSNDLYYQCQQCNKCYATYAGLVKHQQTHAYESTEYKIIRSQPGGSGAIV 311
            ..:..| .::...:....::.|||::|.|.:|:...|..|                         
  Fly   241 FTRNFQLKLHMTAVHGMGEMRYQCEECRKNFASRHSLRYH------------------------- 280

  Fly   312 DQTEFCTDQASALIQAANVASAQSMQKPVGVPRYHCQDCGKSYSTYSGLSKHQQFHCPSAEGNQV 376
                              |.|..|.::|.|     ||.|.:.:...:.|..|.:.|    .|...
  Fly   281 ------------------VKSVHSTERPFG-----CQHCDRRFILRTQLLSHLRTH----TGEAK 318

  Fly   377 KKVFSCKNCDKTYVSLGALKMHIRTHT----LPCKCPICGKAFSRPWLLQGHIRTHTGEKPFSCQ 437
            .::|.|:.|.|::.:...|:.|:|:|.    .|.||..|.|||.....|..|:..|||||||:|:
  Fly   319 PRIFECQRCSKSWPTKSDLRTHMRSHNPNMERPFKCDRCSKAFFTRGHLNSHLLVHTGEKPFACE 383

  Fly   438 HCNRAFADRSNLRAHM-QTHSDV 459
            :|::.:....||..|| :.|:|:
  Fly   384 YCDKCYQSVGNLNNHMVRLHADI 406

Known Domains:


GeneSequenceDomainRegion External IDIdentity
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368 6/20 (30%)
C2H2 Zn finger 317..334 CDD:275368 2/17 (12%)
zf-C2H2 345..367 CDD:278523 5/22 (23%)
C2H2 Zn finger 347..367 CDD:275368 5/20 (25%)
PHA00732 379..>417 CDD:177300 15/42 (36%)
C2H2 Zn finger 382..402 CDD:275368 6/20 (30%)
zf-C2H2_8 405..482 CDD:292531 24/57 (42%)
zf-C2H2 406..428 CDD:278523 8/22 (36%)
C2H2 Zn finger 408..428 CDD:275368 7/20 (35%)
zf-H2C2_2 421..444 CDD:290200 11/23 (48%)
zf-C2H2 434..456 CDD:278523 7/23 (30%)
C2H2 Zn finger 436..456 CDD:275368 6/21 (29%)
zf-H2C2_2 448..473 CDD:290200 6/14 (43%)
C2H2 Zn finger 464..481 CDD:275368
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 8/21 (38%)
C2H2 Zn finger 234..255 CDD:275368 2/21 (10%)
C2H2 Zn finger 264..285 CDD:275368 8/64 (13%)
C2H2 Zn finger 293..313 CDD:275368 5/20 (25%)
zf-C2H2_8 305..373 CDD:292531 21/72 (29%)
C2H2 Zn finger 324..344 CDD:275368 6/20 (30%)
C2H2 Zn finger 354..374 CDD:275368 7/20 (35%)
zf-H2C2_2 366..389 CDD:290200 11/23 (48%)
C2H2 Zn finger 382..403 CDD:275368 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24409
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.