DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wor and CG31612

Sequence 1:NP_476601.1 Gene:wor FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001163042.1 Gene:CG31612 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster

Alignment Length:633 Identity:120/634 (19%)
Similarity:201/634 (32%) Gaps:221/634 (35%)


  Fly    52 KSEPEPQPVPTELRR----RFDAAMNQTKEQLA----------RRIWEETREIARAFPDVFTREE 102
            |:||:|   |...||    |.|...:.....|.          ||:.:::|...:|     ..:|
  Fly   340 KNEPKP---PKRQRRANLLRCDLCRHTMARHLIGKHLISHYHFRRLQQQSRIRRQA-----CLQE 396

  Fly   103 IAKSLARLGYGEFELPPEEEVMEPEPEPEQHLPLRYTRDASPTIIKAEPSDEE------------ 155
            |.|.:..:               ....|.|.:|.|:..:...|.:....|.|.            
  Fly   397 ILKHMGSI---------------VRQSPFQCMPCRFYANTEETFLYHWKSHEHLELTKRLGGTFW 446

  Fly   156 ----QFPLRNYNNNLLKSIAEYEDCMKMQNIKEEIPPIPSPQLFYPPPTPLAEPEDLSVTQRRVL 216
                ||. .|.||::|..:.:......:..:...:|                    :.:.|||.:
  Fly   447 CSFCQFN-SNTNNSMLLHLLDSSHKEVLLALNRSVP--------------------ICIAQRRRI 490

  Fly   217 S---------ENMNLQNVARALLSMQHMAPQHAPPPIDMEEDQENQDINQLKIKSSNDLYYQCQQ 272
            .         .|:.|:         ||...:|  |.:.:             ..::.|.|....:
  Fly   491 QCSRCGMEFLYNIQLR---------QHSITEH--PGLAL-------------TGTAADEYQSRFR 531

  Fly   273 CNKCYAT-------------------------------------YAGLVKHQQ------------ 288
            ||.|.::                                     :..||.|:|            
  Fly   532 CNLCGSSQKSRLALQRHKKHKHHLARYFCAICRLEFDNSLDARRHRSLVIHKQKARPQTSIPQPE 596

  Fly   289 ---THAYESTEYKIIRSQPGGSGAIVDQTEFCTDQASALIQAANVASAQSMQKPVGVPRYHCQDC 350
               .|.......:.:.|.|....|  |....|::....:..:..:|..|:  :......:.|..|
  Fly   597 NEIEHMLREVLEETVPSPPAKRSA--DVNAKCSNSRKTIESSQRLAQHQA--EVHSSDNHLCLSC 657

  Fly   351 GKSYSTYSGLSKHQQFHCPSAEGN--------QVKKVFSCKNC--------DKTYVSLGALKMHI 399
            |.|:.:...|.:|.:...|.|..:        |.|.::||..|        |..|..:    .|.
  Fly   658 GISFESAQALGRHTRSCQPLASTSTPADLSQAQKKSMYSCDQCRFQSQYESDLVYHRI----FHT 718

  Fly   400 RTHTL----PCKCPICGKAFSRPWLLQGHIRTHTGEKPFSCQHCNRAFADRSNLRAHMQT-HSDV 459
            |:.|:    ..:||:|.|.|.: ..|:.|:|.||.||.|.|..|.:.||.|.||:.|:.| |:.|
  Fly   719 RSGTIGKNEVLQCPLCPKNFKK-HSLRAHLRNHTNEKIFECTECLQKFARRHNLKNHVITKHAKV 782

  Fly   460 -----------------KKYSCPTCTKSFSRMSLLAKHLQSGCQTEQSG----GPSGSGGGFDQQ 503
                             .||.|.||.|..::...|..|..|..:..:..    ....|..|...:
  Fly   783 GDKEKKKYAAKDVEQSKPKYQCGTCGKLLAKKYSLKLHEISHSKAVERNYLCHFADCSYAGRTPE 847

  Fly   504 QLQQHLQVY-EEGH----------NPHQLYYAGSVGSSNGEEEEGGEY 540
            .|:.||..: :|.|          ...:|:....:.|::..|:.|.|:
  Fly   848 SLKTHLVSHSQENHKCARINCSYVGKSELHLKRHLKSAHSTEKNGEEW 895

Known Domains:


GeneSequenceDomainRegion External IDIdentity
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368 7/72 (10%)
C2H2 Zn finger 317..334 CDD:275368 2/17 (12%)
zf-C2H2 345..367 CDD:278523 6/22 (27%)
C2H2 Zn finger 347..367 CDD:275368 6/20 (30%)
PHA00732 379..>417 CDD:177300 13/50 (26%)
C2H2 Zn finger 382..402 CDD:275368 6/28 (21%)
zf-C2H2_8 405..482 CDD:292531 32/95 (34%)
zf-C2H2 406..428 CDD:278523 8/22 (36%)
C2H2 Zn finger 408..428 CDD:275368 8/20 (40%)
zf-H2C2_2 421..444 CDD:290200 11/23 (48%)
zf-C2H2 434..456 CDD:278523 10/23 (43%)
C2H2 Zn finger 436..456 CDD:275368 9/21 (43%)
zf-H2C2_2 448..473 CDD:290200 12/43 (28%)
C2H2 Zn finger 464..481 CDD:275368 6/17 (35%)
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 4/24 (17%)
C2H2 Zn finger 731..750 CDD:275368 8/20 (40%)
C2H2 Zn finger 758..779 CDD:275368 9/21 (43%)
C2H2 Zn finger 804..824 CDD:275368 7/20 (35%)
C2H2 Zn finger 834..856 CDD:275368 5/22 (23%)
C2H2 Zn finger 898..918 CDD:275368
zf-H2C2_2 910..935 CDD:290200
C2H2 Zn finger 926..945 CDD:275368
C2H2 Zn finger 957..984 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24409
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.