DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wor and esg

Sequence 1:NP_476601.1 Gene:wor FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_476600.1 Gene:esg FlyBaseID:FBgn0001981 Length:470 Species:Drosophila melanogaster

Alignment Length:541 Identity:200/542 (37%)
Similarity:256/542 (47%) Gaps:132/542 (24%)


  Fly     6 YSRCPLKKRPIMVEESSPEDHLSHDEGPVDLSVASAAV----PME-------------------- 46
            ||:|||||||:..:..:|::|.:....|.||.|....:    |.|                    
  Fly    13 YSKCPLKKRPVNYQFEAPQNHSNTPNEPQDLCVKKMEILEENPSEELINVSDCCEDEGVDVDHTD 77

  Fly    47 -PHWMAKSEPEPQPVPTELRRRFDAAMNQTKEQLARRIWEETREIARAFPDVFTREEIAKSLARL 110
             .|    .|.|.:.|..::    |:..|||:   |..:.......|.|...|...   ..:..:.
  Fly    78 DEH----IEEEDEDVDVDV----DSDPNQTQ---AAALAAAAAVAAAAAASVVVP---TPTYPKY 128

  Fly   111 GYGEFELPP--EEEVMEPEPEPEQHLPLRYTRDASPTIIKAEPSD---EEQFPLRNYNNNLLKSI 170
            .:..|.:.|  .|.......:..|.||||     ...|..:.|||   ....|..:|.:....|:
  Fly   129 PWNNFHMSPYTAEFYRTINQQGHQILPLR-----GDLIAPSSPSDSLGSLSPPPHHYLHGRASSV 188

  Fly   171 AEYEDCMKMQNIKEEIPPIPSPQLFYPPPTPLAEPEDLSVTQRRVLSENMNLQNVARALLSMQHM 235
            :               ||:.|..:..|          :.|.|.|.|....  .....:|....|.
  Fly   189 S---------------PPMRSEIIHRP----------IGVRQHRFLPYPQ--MPGYPSLGGYTHT 226

  Fly   236 APQHAPPPIDMEEDQENQDINQLKIKSSNDLYYQCQQCNKCYATYAGL-----VKHQQTHAYEST 295
            ...|||                :....|.:.||..:......:..:.|     :||:..:...:|
  Fly   227 HHHHAP----------------ISPAYSENSYYSMRSMTPESSCSSSLPEDLSLKHKNLNLNLNT 275

  Fly   296 EYKIIRSQPGGSGAIVDQTEFCTDQASALI------QAANVASAQSMQKPVGVPRYHCQDCGKSY 354
                  ||||             :||:|..      ...|.::.:...:|   |||.|.||.|||
  Fly   276 ------SQPG-------------EQAAAKTGDMSPETMPNASAKKDKNQP---PRYQCPDCQKSY 318

  Fly   355 STYSGLSKHQQFHCPSAEGNQVKKVFSCKNCDKTYVSLGALKMHIRTHTLPCKCPICGKAFSRPW 419
            ||:|||:||||||||:||||||||.||||:||||||||||||||||||||||||.:|||||||||
  Fly   319 STFSGLTKHQQFHCPAAEGNQVKKSFSCKDCDKTYVSLGALKMHIRTHTLPCKCNLCGKAFSRPW 383

  Fly   420 LLQGHIRTHTGEKPFSCQHCNRAFADRSNLRAHMQTHSDVKKYSCPTCTKSFSRMSLLAKHLQSG 484
            ||||||||||||||||||||:||||||||||||:|||||:|||||.:|:|:|||||||.||.:.|
  Fly   384 LLQGHIRTHTGEKPFSCQHCHRAFADRSNLRAHLQTHSDIKKYSCTSCSKTFSRMSLLTKHSEGG 448

  Fly   485 CQTEQSGGPSGSGGGFDQQQL 505
            |       |.||.|.....:|
  Fly   449 C-------PGGSAGSSSSSEL 462

Known Domains:


GeneSequenceDomainRegion External IDIdentity
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368 3/25 (12%)
C2H2 Zn finger 317..334 CDD:275368 4/23 (17%)
zf-C2H2 345..367 CDD:278523 17/22 (77%)
C2H2 Zn finger 347..367 CDD:275368 16/20 (80%)
PHA00732 379..>417 CDD:177300 34/38 (89%)
C2H2 Zn finger 382..402 CDD:275368 19/20 (95%)
zf-C2H2_8 405..482 CDD:292531 66/77 (86%)
zf-C2H2 406..428 CDD:278523 20/22 (91%)
C2H2 Zn finger 408..428 CDD:275368 18/20 (90%)
zf-H2C2_2 421..444 CDD:290200 22/23 (96%)
zf-C2H2 434..456 CDD:278523 20/22 (91%)
C2H2 Zn finger 436..456 CDD:275368 18/20 (90%)
zf-H2C2_2 448..473 CDD:290200 19/25 (76%)
C2H2 Zn finger 464..481 CDD:275368 12/17 (71%)
esgNP_476600.1 zf-C2H2 309..331 CDD:278523 17/22 (77%)
C2H2 Zn finger 311..331 CDD:275370 16/20 (80%)
zf-C2H2 344..366 CDD:278523 21/22 (95%)
C2H2 Zn finger 346..366 CDD:275368 19/20 (95%)
zf-C2H2 370..392 CDD:278523 20/22 (91%)
C2H2 Zn finger 372..392 CDD:275368 18/20 (90%)
zf-H2C2_2 385..408 CDD:290200 22/23 (96%)
zf-C2H2 398..420 CDD:278523 20/22 (91%)
C2H2 Zn finger 400..420 CDD:275368 18/20 (90%)
C2H2 Zn finger 428..444 CDD:275368 11/16 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C123610945
eggNOG 1 0.900 E1_KOG2462
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I2553
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3546
43.910

Return to query results.
Submit another query.