DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wor and CG4496

Sequence 1:NP_476601.1 Gene:wor FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001285707.1 Gene:CG4496 FlyBaseID:FBgn0031894 Length:580 Species:Drosophila melanogaster

Alignment Length:615 Identity:124/616 (20%)
Similarity:203/616 (33%) Gaps:193/616 (31%)


  Fly    39 ASAAVPMEPHWMAKSEPEPQPVPTELRRRFDAAMNQTKEQLARRIWEETREIARAFPDVFTREEI 103
            |...:|.:|......|||...:..:     |..:.....|:.::..|:..||.|.. :...||:.
  Fly    37 ACGLIPPDPVRYEYQEPEENFISID-----DVKIKSFLWQIGQQQREKELEIKRIM-EQEKREKR 95

  Fly   104 AKSLARLGYGEFELPPEEEVMEPEPEPEQHLPLRYTRDASP--TIIKAEPSDEEQFPLRNYNNNL 166
            .|...     |.|...::||:|.:.|..|          ||  .||.|..|      |.::|:::
  Fly    96 EKERR-----EAEKRRDQEVIELDEEEAQ----------SPRGLIISAARS------LAHWNSSI 139

  Fly   167 LKSIAEYEDC-MKMQNIKEEIPPIPSPQLFYPPPTPLAEPEDLSVTQRRVLSENMNL-QNVARAL 229
            .:...:.|.. .::..:..||                 |..|....:...:.|:::| .|....:
  Fly   140 RRVTPDIELIPRRVHRVVAEI-----------------ELSDSDHDEDSEVDEDVSLPSNAVSCV 187

  Fly   230 LSMQHMAPQHAPP------PIDMEEDQENQDINQLKIKSSNDL-------------YYQCQQCNK 275
            |:.|.......|.      |.|.|::|:..::.:.|...|..|             .|:|..|.|
  Fly   188 LNEQRQDGSQNPQELVIIVPSDQEDEQKTDNVIKRKSSGSRRLVKRRPGANRRGRHMYECPDCGK 252

  Fly   276 -------------------------C---YATYAGLVKHQQTHAYE------------------- 293
                                     |   :..::.|.||::.|:::                   
  Fly   253 KVQSNYNLRRHMMIHTGERPFPCDLCERRFREFSDLKKHRRRHSHDPQFICMICHLGAPLEQDST 317

  Fly   294 -----STEYKIIRSQPGGSGAIVDQTEFCTDQASA----LIQAA-------NVASAQSM------ 336
                 .::..:::.||...|.  ..||..:|:...    :.:||       .||:..|:      
  Fly   318 RCADCESKNLMVKPQPEELGE--KTTEEHSDEMEGDDDEIEEAALENEKQPQVATQPSLMVTLIP 380

  Fly   337 ---QKPVGVPRYHCQ--------DCGKSYSTYSGLSKHQQFHCPSAEGNQVKKVFSCKNCDKTYV 390
               ..|..||. |.|        .|..:.|: |.||.         :||...|  |.....::| 
  Fly   381 PIQSPPEKVPS-HTQPSRPPLPRSCSSANSS-SSLSN---------DGNIAGK--SMSRTRRSY- 431

  Fly   391 SLGALKMHIRTHTLPCKCPICGKAFSRPWLLQGHIRTHTGEKPFSCQHCNRAFADRSNLRAHMQT 455
                            .||:|.:.|.....|:.|...|||||||||..|.:.|.:.|.|:.||.|
  Fly   432 ----------------PCPLCHRPFGTRHNLKRHYMIHTGEKPFSCSKCRKPFRECSTLKKHMVT 480

  Fly   456 HSDVKKYSCPTCTKSF-----------SRMSLLAKHLQSGCQTEQSGGPSGSG--GGFDQQQLQQ 507
            |...:.|.|..|...|           :....|:....|..:::..|..|...  ...:.||...
  Fly   481 HVRDRWYKCLRCPSKFRDYLEYSDHKNNHQDQLSSRKSSIYESDDDGDSSVEDCLECCECQQRFT 545

  Fly   508 HLQVYEEGHNPHQL-YYAGSVGSSNGEEEE 536
            .|..|......|.| .|..|:.....||::
  Fly   546 ELDAYTAHLKKHDLELYGMSIDDVADEEQD 575

Known Domains:


GeneSequenceDomainRegion External IDIdentity
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368 7/48 (15%)
C2H2 Zn finger 317..334 CDD:275368 5/28 (18%)
zf-C2H2 345..367 CDD:278523 7/30 (23%)
C2H2 Zn finger 347..367 CDD:275368 6/28 (21%)
PHA00732 379..>417 CDD:177300 6/38 (16%)
C2H2 Zn finger 382..402 CDD:275368 1/20 (5%)
zf-C2H2_8 405..482 CDD:292531 28/88 (32%)
zf-C2H2 406..428 CDD:278523 6/22 (27%)
C2H2 Zn finger 408..428 CDD:275368 6/20 (30%)
zf-H2C2_2 421..444 CDD:290200 13/23 (57%)
zf-C2H2 434..456 CDD:278523 10/22 (45%)
C2H2 Zn finger 436..456 CDD:275368 8/20 (40%)
zf-H2C2_2 448..473 CDD:290200 9/36 (25%)
C2H2 Zn finger 464..481 CDD:275368 4/28 (14%)
CG4496NP_001285707.1 zf-C2H2 245..267 CDD:278523 4/22 (18%)
C2H2 Zn finger 247..267 CDD:275368 3/20 (15%)
zf-H2C2_2 259..282 CDD:290200 1/23 (4%)
C2H2 Zn finger 275..295 CDD:275368 4/20 (20%)
zf-C2H2 431..453 CDD:278523 7/39 (18%)
C2H2 Zn finger 433..453 CDD:275368 6/20 (30%)
zf-H2C2_2 445..468 CDD:290200 12/23 (52%)
C2H2 Zn finger 461..481 CDD:275368 8/20 (40%)
C2H2 Zn finger 489..510 CDD:275368 3/21 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24409
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.