DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wor and SNAI3

Sequence 1:NP_476601.1 Gene:wor FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_840101.1 Gene:SNAI3 HGNCID:18411 Length:292 Species:Homo sapiens

Alignment Length:156 Identity:103/157 (66%)
Similarity:120/157 (76%) Gaps:11/157 (7%)


  Fly   337 QKPVGVPR-------YHCQDCGKSYSTYSGLSKHQQFHCPSAEGNQVKKVFSCKNCDKTYVSLGA 394
            :|.:|..|       :.|..|.|.|.|.:||::|:|.||..    ||.:||:||.|||.|.||||
Human   137 EKLLGAERMPRAPGGFECFHCHKPYHTLAGLARHRQLHCHL----QVGRVFTCKYCDKEYTSLGA 197

  Fly   395 LKMHIRTHTLPCKCPICGKAFSRPWLLQGHIRTHTGEKPFSCQHCNRAFADRSNLRAHMQTHSDV 459
            ||||||||||||.|.|||||||||||||||:||||||||::|.||:||||||||||||:|||||.
Human   198 LKMHIRTHTLPCTCKICGKAFSRPWLLQGHVRTHTGEKPYACSHCSRAFADRSNLRAHLQTHSDA 262

  Fly   460 KKYSCPTCTKSFSRMSLLAKHLQSGC 485
            |||.|..|||:||||||||:|.:|||
Human   263 KKYRCRRCTKTFSRMSLLARHEESGC 288

Known Domains:


GeneSequenceDomainRegion External IDIdentity
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368
C2H2 Zn finger 317..334 CDD:275368
zf-C2H2 345..367 CDD:278523 9/22 (41%)
C2H2 Zn finger 347..367 CDD:275368 9/20 (45%)
PHA00732 379..>417 CDD:177300 32/38 (84%)
C2H2 Zn finger 382..402 CDD:275368 17/20 (85%)
zf-C2H2_8 405..482 CDD:292531 62/77 (81%)
zf-C2H2 406..428 CDD:278523 19/22 (86%)
C2H2 Zn finger 408..428 CDD:275368 18/20 (90%)
zf-H2C2_2 421..444 CDD:290200 18/23 (78%)
zf-C2H2 434..456 CDD:278523 17/22 (77%)
C2H2 Zn finger 436..456 CDD:275368 17/20 (85%)
zf-H2C2_2 448..473 CDD:290200 19/25 (76%)
C2H2 Zn finger 464..481 CDD:275368 13/17 (76%)
SNAI3NP_840101.1 SNAG domain. {ECO:0000250} 1..20
C2H2 Zn finger 154..174 CDD:275370 9/20 (45%)
C2H2 Zn finger 185..205 CDD:275368 17/20 (85%)
COG5048 <206..>278 CDD:227381 59/72 (82%)
C2H2 Zn finger 211..231 CDD:275368 18/20 (90%)
C2H2 Zn finger 239..259 CDD:275368 17/20 (85%)
C2H2 Zn finger 267..283 CDD:275368 12/16 (75%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C146025384
eggNOG 1 0.900 E1_KOG2462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T130148
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
43.790

Return to query results.
Submit another query.