DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wor and CG3847

Sequence 1:NP_476601.1 Gene:wor FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_572317.2 Gene:CG3847 FlyBaseID:FBgn0029867 Length:380 Species:Drosophila melanogaster

Alignment Length:419 Identity:85/420 (20%)
Similarity:144/420 (34%) Gaps:162/420 (39%)


  Fly   177 MKMQNIKEEIPPIPSPQLFYPPPTPLAEPEDLSVTQRRVLSENMNLQNVARALLSMQHMAPQHAP 241
            :|...:||||.|:            |.| :|..|.                         |:..|
  Fly     6 VKYSMVKEEIVPV------------LIE-QDTEVD-------------------------PEEEP 32

  Fly   242 PPIDMEEDQEN--QDINQLKIKSSNDLYYQCQQCNKCYATYAGLVKHQQTHAY-----ESTEYKI 299
                 |||:|:  :|..|                           :.|.|:||     :.||..:
  Fly    33 -----EEDEEHVQEDDGQ---------------------------ETQYTYAYTTGDDDDTETAV 65

  Fly   300 IRSQPGGSGAIVDQTEFCTDQ------ASALIQAANVASAQSMQKPVG-------VPRYHCQDCG 351
            :........|:|:..|...|:      ...|::.:.| ..:::::..|       ||..|.::..
  Fly    66 VTLSDRDHEALVNAEEVIIDENGHAVTLQELVENSTV-EEETIEQGDGTHTILHIVPNIHGEEVE 129

  Fly   352 KSYSTYSG--LSKHQQFHCPSAEGNQVK--------------------------KVFSCKNCDKT 388
            :......|  :....:|.....||.:::                          |.|.|.||...
  Fly   130 EDEELEDGEEVEHDDEFVTVDHEGGELEVEDDEVGSIVFESTIDHAEQDPYGRNKTFYCPNCGNC 194

  Fly   389 YVSLGALKMHIRT--------HTLPCKCPICGKAFSRPWLLQGHIRTHTGEKPFSCQHCNRAFAD 445
            |.:.|:||:|:|.        .|...||.:|.|.|:....|:.|:..||||:||.|..|.|.|.:
  Fly   195 YSAAGSLKLHMRACLRQRNEISTDERKCKVCSKVFNSVAYLKEHMMRHTGEQPFRCTRCYRKFVE 259

  Fly   446 RSNLRAHMQTHSD---------------------VKKYSCPTCTKSFSRM----SLLAKHLQSGC 485
            .|...|||::|..                     ||::.|..|:::|:.:    .:..::....|
  Fly   260 ESKFTAHMESHKHQDKLEAEAVALAAQHGGKKVVVKEFQCAFCSQNFTVVFDVGQVKRRYACDAC 324

  Fly   486 QTEQSGGPSGSGGGFDQQQLQQHLQVYEE 514
            :.:.|          :.:.|:||.|..||
  Fly   325 RDKYS----------NAEALRQHKQQVEE 343

Known Domains:


GeneSequenceDomainRegion External IDIdentity
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368 2/20 (10%)
C2H2 Zn finger 317..334 CDD:275368 3/23 (13%)
zf-C2H2 345..367 CDD:278523 3/24 (13%)
C2H2 Zn finger 347..367 CDD:275368 2/22 (9%)
PHA00732 379..>417 CDD:177300 16/46 (35%)
C2H2 Zn finger 382..402 CDD:275368 9/28 (32%)
zf-C2H2_8 405..482 CDD:292531 27/102 (26%)
zf-C2H2 406..428 CDD:278523 7/22 (32%)
C2H2 Zn finger 408..428 CDD:275368 6/20 (30%)
zf-H2C2_2 421..444 CDD:290200 12/23 (52%)
zf-C2H2 434..456 CDD:278523 9/22 (41%)
C2H2 Zn finger 436..456 CDD:275368 8/20 (40%)
zf-H2C2_2 448..473 CDD:290200 9/46 (20%)
C2H2 Zn finger 464..481 CDD:275368 3/21 (14%)
CG3847NP_572317.2 C2H2 Zn finger 188..216 CDD:275368 9/28 (32%)
C2H2 Zn finger 222..242 CDD:275368 6/20 (30%)
C2H2 Zn finger 250..270 CDD:275368 8/20 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24409
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.