DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wor and snai-1

Sequence 1:NP_476601.1 Gene:wor FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_499902.2 Gene:snai-1 WormBaseID:WBGene00019299 Length:193 Species:Caenorhabditis elegans

Alignment Length:182 Identity:94/183 (51%)
Similarity:121/183 (66%) Gaps:21/183 (11%)


  Fly   327 AANVASAQSM--QKPVGVPRYHCQDCGKSYSTYSGLSKHQQFHCPSAEGNQVKKVFSCKNCDKTY 389
            :::.||..|:  ||.|      ||.|.|:|.||.||.:|.|||   .||   |...||.:|.|.|
 Worm    27 SSSSASCSSLDNQKLV------CQFCKKTYLTYFGLRRHLQFH---KEG---KLQQSCPHCKKVY 79

  Fly   390 VSLGALKMHIRTHTLPCKCPICGKAFSRPWLLQGHIRTHTGEKPFSCQHCNRAFADRSNLRAHMQ 454
            .|.||||||::||:|||.|..|||:|||||||:||:|||||||||.|:.|.|.||||||||||:|
 Worm    80 RSPGALKMHLKTHSLPCVCNDCGKSFSRPWLLKGHLRTHTGEKPFGCEFCGRCFADRSNLRAHLQ 144

  Fly   455 THSDVKKYSCPTCTKSFSRMSLLAKHLQSGCQTEQSGGPSGSGGGFDQQQLQ 506
            |||..||:.|..|.:||:|:.:..:|.|. |:    ||  ||||..:::.::
 Worm   145 THSGEKKHRCSRCGQSFARVQVRQRHEQC-CR----GG--GSGGEAEKEDVE 189

Known Domains:


GeneSequenceDomainRegion External IDIdentity
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368
C2H2 Zn finger 317..334 CDD:275368 2/7 (29%)
zf-C2H2 345..367 CDD:278523 12/22 (55%)
C2H2 Zn finger 347..367 CDD:275368 12/20 (60%)
PHA00732 379..>417 CDD:177300 23/38 (61%)
C2H2 Zn finger 382..402 CDD:275368 12/20 (60%)
zf-C2H2_8 405..482 CDD:292531 49/77 (64%)
zf-C2H2 406..428 CDD:278523 16/22 (73%)
C2H2 Zn finger 408..428 CDD:275368 15/20 (75%)
zf-H2C2_2 421..444 CDD:290200 16/23 (70%)
zf-C2H2 434..456 CDD:278523 16/22 (73%)
C2H2 Zn finger 436..456 CDD:275368 15/20 (75%)
zf-H2C2_2 448..473 CDD:290200 15/25 (60%)
C2H2 Zn finger 464..481 CDD:275368 6/17 (35%)
snai-1NP_499902.2 C2H2 Zn finger 72..92 CDD:275368 12/20 (60%)
COG5048 98..>155 CDD:227381 42/57 (74%)
C2H2 Zn finger 98..118 CDD:275368 15/20 (75%)
C2H2 Zn finger 126..146 CDD:275368 15/20 (75%)
zf-H2C2_2 138..163 CDD:290200 15/25 (60%)
C2H2 Zn finger 154..170 CDD:275368 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T374997
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3546
TreeFam 1 0.960
54.990

Return to query results.
Submit another query.