DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wor and scrt-1

Sequence 1:NP_476601.1 Gene:wor FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_491001.2 Gene:scrt-1 WormBaseID:WBGene00016948 Length:178 Species:Caenorhabditis elegans

Alignment Length:133 Identity:61/134 (46%)
Similarity:76/134 (57%) Gaps:32/134 (24%)


  Fly   353 SYSTYSGLSKHQQFHCPSAEGNQVKKVFSCKNCDKTYVSLGALKMHIRTHTLPCKCPICGKAFSR 417
            ||||.|           |.:|.|:|                     ..|.:..|:|.:|||.|||
 Worm    73 SYSTPS-----------SPDGKQLK---------------------FATCSPVCQCKVCGKRFSR 105

  Fly   418 PWLLQGHIRTHTGEKPFSCQHCNRAFADRSNLRAHMQTHSDVKKYSCPTCTKSFSRMSLLAKHLQ 482
            .||||||:|||||||||.|:.|::.|||:||||||:||||..|.:.||.|.|||:..|.|:||.:
 Worm   106 QWLLQGHLRTHTGEKPFQCEICSKRFADKSNLRAHIQTHSGTKPHKCPRCGKSFALKSYLSKHEE 170

  Fly   483 SGC 485
            |.|
 Worm   171 SKC 173

Known Domains:


GeneSequenceDomainRegion External IDIdentity
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368
C2H2 Zn finger 317..334 CDD:275368
zf-C2H2 345..367 CDD:278523 5/14 (36%)
C2H2 Zn finger 347..367 CDD:275368 5/14 (36%)
PHA00732 379..>417 CDD:177300 8/38 (21%)
C2H2 Zn finger 382..402 CDD:275368 1/20 (5%)
zf-C2H2_8 405..482 CDD:292531 49/77 (64%)
zf-C2H2 406..428 CDD:278523 16/22 (73%)
C2H2 Zn finger 408..428 CDD:275368 15/20 (75%)
zf-H2C2_2 421..444 CDD:290200 16/23 (70%)
zf-C2H2 434..456 CDD:278523 14/22 (64%)
C2H2 Zn finger 436..456 CDD:275368 13/20 (65%)
zf-H2C2_2 448..473 CDD:290200 16/25 (64%)
C2H2 Zn finger 464..481 CDD:275368 10/17 (59%)
scrt-1NP_491001.2 zf-C2H2 94..116 CDD:278523 16/22 (73%)
C2H2 Zn finger 96..116 CDD:275368 15/20 (75%)
zf-H2C2_2 109..132 CDD:290200 16/23 (70%)
C2H2 Zn finger 124..144 CDD:275368 13/20 (65%)
zf-H2C2_2 136..160 CDD:290200 16/24 (67%)
C2H2 Zn finger 152..168 CDD:275368 9/16 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.