powered by:
Protein Alignment wor and scrt-1
DIOPT Version :9
| Sequence 1: | NP_476601.1 |
Gene: | wor / 34906 |
FlyBaseID: | FBgn0001983 |
Length: | 548 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_491001.2 |
Gene: | scrt-1 / 183848 |
WormBaseID: | WBGene00016948 |
Length: | 178 |
Species: | Caenorhabditis elegans |
| Alignment Length: | 133 |
Identity: | 61/133 - (45%) |
| Similarity: | 76/133 - (57%) |
Gaps: | 32/133 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 353 SYSTYSGLSKHQQFHCPSAEGNQVKKVFSCKNCDKTYVSLGALKMHIRTHTLPCKCPICGKAFSR 417
||||.| |.:|.|:| ..|.:..|:|.:|||.|||
Worm 73 SYSTPS-----------SPDGKQLK---------------------FATCSPVCQCKVCGKRFSR 105
Fly 418 PWLLQGHIRTHTGEKPFSCQHCNRAFADRSNLRAHMQTHSDVKKYSCPTCTKSFSRMSLLAKHLQ 482
.||||||:|||||||||.|:.|::.|||:||||||:||||..|.:.||.|.|||:..|.|:||.:
Worm 106 QWLLQGHLRTHTGEKPFQCEICSKRFADKSNLRAHIQTHSGTKPHKCPRCGKSFALKSYLSKHEE 170
Fly 483 SGC 485
|.|
Worm 171 SKC 173
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2462 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.