DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment esg and WIP4

DIOPT Version :9

Sequence 1:NP_476600.1 Gene:esg / 34903 FlyBaseID:FBgn0001981 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_188724.2 Gene:WIP4 / 821637 AraportID:AT3G20880 Length:412 Species:Arabidopsis thaliana


Alignment Length:295 Identity:66/295 - (22%)
Similarity:105/295 - (35%) Gaps:72/295 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 SPPMRSEIIHRPIGVRQHRFLPYPQMPGYPSLGGYTHTHHHHAPISPAYSENSYYSMRSMTPESS 253
            |||:|..             ||         |...:..|.|..|.:   :.:.||.|.  |.|:|
plant   122 SPPLREA-------------LP---------LLSLSPIHKHQEPTA---NHHEYYFME--TTETS 159

  Fly   254 CSSSLPEDL--SLKHK-NLNLNLNTSQPGEQAAAKTGDMSPETMPNASAKKDKNQPPRYQCPDCQ 315
            .:|:..:..  |.:|. .::|:|.....|: ..:.:.|:..::..:.....|.:|....:.....
plant   160 SNSNFLDQCQDSYRHDVTVDLHLGLPNLGD-GGSSSSDVVLDSTDHQEGHHDHHQDQGLEVTMAS 223

  Fly   316 KSYSTFSGLTKHQQFH---CPAAEGNQV---KKSFSCKDCDKTYVSLGALKMHIRTH-------- 366
            .......||.:....|   .|..  :|:   ...|||..|.||:.....::||:..|        
plant   224 DHDDEHGGLQRGNHLHHFWIPTP--SQILMGPTQFSCPLCFKTFNRYNNMQMHMWGHGSQYRKGP 286

  Fly   367 ------------TLPCKC------NLCGKAFSRPW----LLQGHIRTHTGEKPFSCQHCHRAFAD 409
                        .|||.|      |......:||.    .||.|.:...|.:||:|:.|.:|||.
plant   287 ESLRGTQPTAMLKLPCYCCAPGCKNNIDHPRARPLKDFRTLQTHYKRKHGVRPFACRRCGKAFAV 351

  Fly   410 RSNLRAHLQTHSDIKKYSCTSCSKTFSRMSLLTKH 444
            :.:.|.|.:...  |.:.| ||...|.....|..|
plant   352 KGDWRTHEKNCG--KLWYC-SCGSDFKHKRSLKDH 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
esgNP_476600.1 zf-C2H2 309..331 CDD:278523 2/21 (10%)
C2H2 Zn finger 311..331 CDD:275370 2/19 (11%)
zf-C2H2 344..366 CDD:278523 8/21 (38%)
C2H2 Zn finger 346..366 CDD:275368 6/19 (32%)
zf-C2H2 370..392 CDD:278523 8/31 (26%)
C2H2 Zn finger 372..392 CDD:275368 7/29 (24%)
zf-H2C2_2 385..408 CDD:290200 9/22 (41%)
zf-C2H2 398..420 CDD:278523 8/21 (38%)
C2H2 Zn finger 400..420 CDD:275368 7/19 (37%)
C2H2 Zn finger 428..444 CDD:275368 5/15 (33%)
WIP4NP_188724.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I2624
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.