DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nht and TAF4

Sequence 1:NP_523574.4 Gene:nht FlyBaseID:FBgn0041103 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_013718.1 Gene:TAF4 SGDID:S000004607 Length:388 Species:Saccharomyces cerevisiae

Alignment Length:242 Identity:53/243 (22%)
Similarity:100/243 (41%) Gaps:42/243 (17%)


  Fly    28 SGSQDASKAKV---SIKKNQRASFF---DRSSIYKKIMKHLSQGNQADDINISEQEWLLDSFLAA 86
            :.|.:|||::|   ::|......|.   ..|:..:|:.|     .|..::..::...:||...:|
Yeast   163 NSSINASKSQVQTNNVKIPNHLPFLHPEQVSNYMRKVGK-----EQNFNLTPTKNPEILDMMSSA 222

  Fly    87 LETYMKHVVKKTIELCEH-RTSYHLHNDERCVMKNDMRVTMMFLNDLEIADYGSSDDETGFYRKR 150
            .|.||:.::...|.:..| |.:..:::..|..:...:|...:.          ...:|....:||
Yeast   223 CENYMRDILTNAIVISRHRRKAVKINSGRRSEVSAALRAIALI----------QKKEEERRVKKR 277

  Fly   151 RA---ENIDEERKVARLESV----NDTALLAISGRKRPGEQLAPESAPSGSKVAKLTGAPIQRAC 208
            .|   |..|.|.|:...|::    |.||.|....:|:.|...:..:.|: |..||.:|.......
Yeast   278 IALGLEKEDYENKIDSEETLHRASNVTAGLRAGSKKQYGWLTSSVNKPT-SLGAKSSGKVASDIT 341

  Fly   209 AP-----RFKHMN------IRDVLQFMEEDRRYARSNMLFEAYLKYK 244
            |.     :|:...      :||:| |..|:||.:...::.:.|.|.:
Yeast   342 ARGESGLKFREAREEPGIVMRDLL-FALENRRNSVQTIISKGYAKIR 387

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nhtNP_523574.4 TAF4 10..238 CDD:173965 51/235 (22%)
TAF4NP_013718.1 TAF4 144..383 CDD:310095 51/237 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2341
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001222
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR15138
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.