DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nht and TAF4B

Sequence 1:NP_523574.4 Gene:nht FlyBaseID:FBgn0041103 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_174093.3 Gene:TAF4B AraportID:AT1G27720 Length:720 Species:Arabidopsis thaliana

Alignment Length:269 Identity:54/270 (20%)
Similarity:96/270 (36%) Gaps:89/270 (33%)


  Fly    25 LPDSGSQDASKAKVSIKKNQRASFFDRSSIYKKIMKHLSQGNQADDI--NISEQEWLLDSFLAAL 87
            |.|||.          |||.|.|         |..:.|..|.:...:  .|..|..|.:....:.
plant   481 LLDSGP----------KKNDRVS---------KAYRRLVHGEEERTLLQKIPLQRKLTEIMGKSG 526

  Fly    88 ETYMKHVVKKTIELC-EHRTSYHLHN----------DERC----VMKNDMRVTMMFL-------- 129
            ..::.|.|::.:.|| |.|....|.|          .|:|    .:.:|:|..:..:        
plant   527 LKHIDHDVERCLSLCVEERMRGLLFNIIRISKQRTDAEKCRNRTFITSDIRKEINEMNQKVKEEW 591

  Fly   130 ------------NDLEIADYGSSDDETGFYRKRRAENIDEERKVARLESVNDTALLAISG----- 177
                        ||.|..|..|::        .:|...||:::  |.::.|.....|:.|     
plant   592 EKKHSGEEKNKENDTEKEDQRSNE--------VKANKKDEDKE--RAKAANVAVRAAVGGDDRFS 646

  Fly   178 ----------RKRPGEQLAPESAPSGSKVAKLTGAP-IQRACAPRFKHMNIRDVLQFMEEDRRYA 231
                      |..||.....:....|::..|..|.| :.|:       ::::||:..:|::.:.:
plant   647 KWKLMAEARQRSSPGPGRNSKKLSGGTQFGKNQGLPKVVRS-------ISVKDVIAVVEKEPQMS 704

  Fly   232 RSNMLFEAY 240
            ||.:|:..|
plant   705 RSTLLYRVY 713

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nhtNP_523574.4 TAF4 10..238 CDD:173965 53/266 (20%)
TAF4BNP_174093.3 RST 89..144 CDD:288985
TAF4 463..711 CDD:283017 53/266 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR15138
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.