DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nht and TAF4

Sequence 1:NP_523574.4 Gene:nht FlyBaseID:FBgn0041103 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001190458.1 Gene:TAF4 AraportID:AT5G43130 Length:852 Species:Arabidopsis thaliana

Alignment Length:46 Identity:10/47 (21%)
Similarity:28/47 (60%) Gaps:5/47 (11%)


  Fly   193 GSKVAKLTGAPIQRACAPR-FKHMNIRDVLQFMEEDRRYARSNMLF 237
            |.:|.|..|:.:|    |: .:.::::||:..:|.:.:.::|.:::
plant   807 GRRVGKNQGSSLQ----PKVVRTISVKDVVAVLEREPQMSKSTLMY 848

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nhtNP_523574.4 TAF4 10..238 CDD:173965 10/47 (21%)
TAF4NP_001190458.1 Med15 <82..529 CDD:255446
RST 187..250 CDD:288985
TAF4 537..850 CDD:283017 10/47 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR15138
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.