DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nht and taf4

Sequence 1:NP_523574.4 Gene:nht FlyBaseID:FBgn0041103 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001072285.1 Gene:taf4 XenbaseID:XB-GENE-488490 Length:1033 Species:Xenopus tropicalis

Alignment Length:312 Identity:64/313 (20%)
Similarity:112/313 (36%) Gaps:86/313 (27%)


  Fly     9 PIQ-------PYAGQLLIINDLILPDSGSQDASKAKVSIKKNQRASFFDRSSIYKKIMKHLSQGN 66
            |:|       |.|.|.|:.....:....:|.|:..|..:|:....||.|...|        :...
 Frog   730 PLQTGAMQTVPMAKQALVQGAKTMSAISAQAAAAQKNKLKEPGGGSFRDDDDI--------NDVA 786

  Fly    67 QADDINISEQE----------------------WLLDSFL--AALETYMKH----VVKKTIELCE 103
            ....:|:||:.                      :||.:.|  ..||...||    :.:..:....
 Frog   787 SMAGVNLSEESARILATNSELVGTLTRSCKDETFLLPALLQRRILEIGKKHGITEIHQDVVSYVS 851

  Fly   104 HRTSYHLHN------------------DERCVMKNDMRVTMMFLNDLEIADYGSSDDETG--FYR 148
            |.|...|.|                  |:|....:|:|..:.|...|:..:....|::..  ..|
 Frog   852 HATQQRLQNIVEKISETAQQKNISHKDDDRYEQTSDVRTQLKFFEQLDQIEKQRKDEQEREILMR 916

  Fly   149 KRRAENIDEERKVARLE-----------------SVNDTALLAISGRKR-----PGEQLAPESAP 191
            ..::.:..|:.:..||:                 ..|.|||.||..||:     ||.....||:.
 Frog   917 AAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVESPGPGSGSESSS 981

  Fly   192 SGSKVAKLT-GAPIQRACAPRFKHMNIRDVLQFMEEDRRYARSNMLFEAYLK 242
            :.:..|..: |...::....|...:|:||::..:|.:|..:.|.:|::|:||
 Frog   982 TSTATASSSAGGGSRQFTRQRITRVNLRDLILCLESERETSHSLLLYKAFLK 1033

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nhtNP_523574.4 TAF4 10..238 CDD:173965 60/306 (20%)
taf4NP_001072285.1 TAFH 541..619 CDD:284862
TAF4 782..1030 CDD:283017 48/256 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2341
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001222
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.