DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nht and Taf4b

Sequence 1:NP_523574.4 Gene:nht FlyBaseID:FBgn0041103 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001093919.1 Gene:Taf4b MGIID:2152345 Length:855 Species:Mus musculus

Alignment Length:260 Identity:56/261 (21%)
Similarity:106/261 (41%) Gaps:51/261 (20%)


  Fly    20 INDLILPDSGSQDASKAKV----------SIKKNQRASFFDRSSIYKKIM----KHLSQGNQADD 70
            |||:......:.|...|.:          .|:..:...|....::.|:|:    ||......:|.
Mouse   610 INDVTFMAEVNLDEENACILAAHSDFVGTLIQSCKEEPFLVIGALQKRILDIGKKHDITELNSDA 674

  Fly    71 INISEQEWLLDSFLAALETYMKHVVKKTIELCEHRTSYHLHNDERCVMKNDMRVTMMFL------ 129
            :|:...         |.:..::.:::|...:.:||.:.: ...|..::..|.|..:.||      
Mouse   675 VNLISH---------ATQERLRGLLEKLTTIAQHRMTIY-KGSENYILSTDTRSQLKFLEKLDQL 729

  Fly   130 ----NDLEIADY--------GSSDDETGFYRKRRAENIDEERKVARLE--SVNDTALLAISGRKR 180
                .|||..:.        .:.:|......|::|:.: ::.::|:::  ..|.|||.||..||:
Mouse   730 EKQRKDLEEREMLLKAAKSRSNKEDPEQLRLKQKAKEL-QQLELAQIQYRDANLTALAAIGPRKK 793

  Fly   181 PGEQLAPES---APSGSKVAKLTGAPIQRACAPRFKHMNIRDVLQFMEEDRRYARSNMLFEAYLK 242
            ...:...||   .||.|..:.||..   :...||...:.:||::..||::|....|..|:.|.||
Mouse   794 RPLESGNESFKDNPSTSGTSSLTAT---KPFRPRITRICLRDLIFCMEQEREMKYSRALYLALLK 855

  Fly   243  242
            Mouse   856  855

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nhtNP_523574.4 TAF4 10..238 CDD:173965 53/255 (21%)
Taf4bNP_001093919.1 TAFH 257..343 CDD:284862
Required for interaction with P65/RELA. {ECO:0000250|UniProtKB:Q92750} 504..526
Nuclear export signal. {ECO:0000250|UniProtKB:Q92750} 509..549
TAF4 610..850 CDD:283017 53/254 (21%)
Required for interaction with TAF12. {ECO:0000250|UniProtKB:Q92750} 823..855 11/32 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2341
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001222
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR15138
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.