DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nht and TAF4B

DIOPT Version :10

Sequence 1:NP_523574.4 Gene:nht / 34902 FlyBaseID:FBgn0041103 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001280654.1 Gene:TAF4B / 6875 HGNCID:11538 Length:867 Species:Homo sapiens


Alignment Length:220 Identity:53/220 - (24%)
Similarity:98/220 - (44%) Gaps:46/220 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SIYKKIM----KHLSQGNQADDINISEQEWLLDSFLAALETYMKHVVKKTIELCEHR-TSYHLHN 112
            ::.|:|:    ||......:|.:|:..|         |.:..::.:::|...:.:|| |:|..  
Human   664 ALQKRILDIGKKHDITELNSDAVNLISQ---------ATQERLRGLLEKLTAIAQHRMTTYKA-- 717

  Fly   113 DERCVMKNDMRVTMMFL----------NDLEIADY--------GSSDDETGFYRKRRAENIDEER 159
            .|..::.:|.|..:.||          .|||..:.        .:.:|......|::|:.: ::.
Human   718 SENYILCSDTRSQLKFLEKLDQLEKQRKDLEEREMLLKAAKSRSNKEDPEQLRLKQKAKEL-QQL 781

  Fly   160 KVARLE--SVNDTALLAISGR-KRPGEQ----LAPESAPSGSKVAKLTGAPIQRACAPRFKHMNI 217
            ::|:::  ..|.|||.||..| |||.|.    |......||:  :.||..  ::...||...:.:
Human   782 ELAQIQHRDANLTALAAIGPRKKRPLESGIEGLKDNLLASGT--SSLTAT--KQLHRPRITRICL 842

  Fly   218 RDVLQFMEEDRRYARSNMLFEAYLK 242
            ||::..||::|....|..|:.|.||
Human   843 RDLIFCMEQEREMKYSRALYLALLK 867

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nhtNP_523574.4 TAF4 <85..237 CDD:461598 42/177 (24%)
TAF4BNP_001280654.1 PHA03247 <14..154 CDD:223021
Sufficient for interaction with ZNF628. /evidence=ECO:0000250|UniProtKB:G5E8Z2 100..241
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..239
TAFH 258..349 CDD:462195
TAF4 621..862 CDD:461598 49/213 (23%)
Required for interaction with TAF12. /evidence=ECO:0000269|PubMed:15601843 835..867 10/31 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.