DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nht and TAF4B

DIOPT Version :9

Sequence 1:NP_523574.4 Gene:nht / 34902 FlyBaseID:FBgn0041103 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001280654.1 Gene:TAF4B / 6875 HGNCID:11538 Length:867 Species:Homo sapiens


Alignment Length:220 Identity:53/220 - (24%)
Similarity:98/220 - (44%) Gaps:46/220 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SIYKKIM----KHLSQGNQADDINISEQEWLLDSFLAALETYMKHVVKKTIELCEHR-TSYHLHN 112
            ::.|:|:    ||......:|.:|:..|         |.:..::.:::|...:.:|| |:|..  
Human   664 ALQKRILDIGKKHDITELNSDAVNLISQ---------ATQERLRGLLEKLTAIAQHRMTTYKA-- 717

  Fly   113 DERCVMKNDMRVTMMFL----------NDLEIADY--------GSSDDETGFYRKRRAENIDEER 159
            .|..::.:|.|..:.||          .|||..:.        .:.:|......|::|:.: ::.
Human   718 SENYILCSDTRSQLKFLEKLDQLEKQRKDLEEREMLLKAAKSRSNKEDPEQLRLKQKAKEL-QQL 781

  Fly   160 KVARLE--SVNDTALLAISGR-KRPGEQ----LAPESAPSGSKVAKLTGAPIQRACAPRFKHMNI 217
            ::|:::  ..|.|||.||..| |||.|.    |......||:  :.||..  ::...||...:.:
Human   782 ELAQIQHRDANLTALAAIGPRKKRPLESGIEGLKDNLLASGT--SSLTAT--KQLHRPRITRICL 842

  Fly   218 RDVLQFMEEDRRYARSNMLFEAYLK 242
            ||::..||::|....|..|:.|.||
Human   843 RDLIFCMEQEREMKYSRALYLALLK 867

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nhtNP_523574.4 TAF4 10..238 CDD:173965 50/214 (23%)
TAF4BNP_001280654.1 Sufficient for interaction with ZNF628. /evidence=ECO:0000250|UniProtKB:G5E8Z2 100..241
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..239
TAFH 258..346 CDD:284862
TAF4 621..862 CDD:283017 49/213 (23%)
Required for interaction with TAF12. /evidence=ECO:0000269|PubMed:15601843 835..867 10/31 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2341
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001841
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15138
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.