DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nht and TAF4

Sequence 1:NP_523574.4 Gene:nht FlyBaseID:FBgn0041103 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_003176.2 Gene:TAF4 HGNCID:11537 Length:1085 Species:Homo sapiens

Alignment Length:317 Identity:65/318 (20%)
Similarity:114/318 (36%) Gaps:101/318 (32%)


  Fly     9 PIQPYAGQLLIINDLILPDSGSQDASKAK-VSIKKNQRASFFDRSSIYKKIMKHLSQGNQADD-- 70
            |:||    :.::...:||.:.:..|..|: .:.:||:              :|....|:..||  
Human   787 PLQP----VPVVKPAVLPGTKALSAVSAQAAAAQKNK--------------LKEPGGGSFRDDDD 833

  Fly    71 ---------INISEQE----------------------WLLDSFL--AALETYMKHVVKK----T 98
                     :|:||:.                      :||.:.|  ..||...||.:.:    .
Human   834 INDVASMAGVNLSEESARILATNSELVGTLTRSCKDETFLLQAPLQRRILEIGKKHGITELHPDV 898

  Fly    99 IELCEHRTSYHLHN------------------DERCVMKNDMRVTMMFLNDLEIADYGSSDDETG 145
            :....|.|...|.|                  |:|....:|:|..:.|...|:..:....|::..
Human   899 VSYVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDEQER 963

  Fly   146 --FYRKRRAENIDEERKVARLE-----------------SVNDTALLAISGRKR-----PGEQLA 186
              ..|..::.:..|:.:..||:                 ..|.|||.||..||:     ||....
Human   964 EILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVDCPGPGSG 1028

  Fly   187 PESAPSGSKVAKLTGAPIQRA-CAPRFKHMNIRDVLQFMEEDRRYARSNMLFEAYLK 242
            .|.:..||.|...:|....|. ...|...:|:||::..:|.:|..:.|.:|::|:||
Human  1029 AEGSGPGSVVPGSSGVGTPRQFTRQRITRVNLRDLIFCLENERETSHSLLLYKAFLK 1085

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nhtNP_523574.4 TAF4 10..238 CDD:173965 61/311 (20%)
TAF4NP_003176.2 TAFH 592..675 CDD:284862
TAF4 834..1082 CDD:283017 49/248 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2341
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001222
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR15138
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.