DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nht and Taf4

Sequence 1:NP_523574.4 Gene:nht FlyBaseID:FBgn0041103 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001137958.1 Gene:Taf4 FlyBaseID:FBgn0010280 Length:1088 Species:Drosophila melanogaster

Alignment Length:180 Identity:55/181 (30%)
Similarity:83/181 (46%) Gaps:26/181 (14%)


  Fly    86 ALETYMKHVVKKTIELCEHRTSYHLHNDERCVMKNDMRVTMMFLNDLEIADYGS----------- 139
            |.:..:|::|:|...:.|||... :..|.|.....|:|..:.||.:|:.|:...           
  Fly   912 ACQERLKNIVEKLAVIAEHRIDV-IKLDPRYEPAKDVRGQIKFLEELDKAEQKRHEELEREMLLR 975

  Fly   140 --------SDDETGFYRKRRAENIDEERKVARLESVNDTALLAISGRKR---PGEQLAPESAPSG 193
                    .|.|....:.|..|....|.:..|....|.|||.||..||:   .||.::..:..||
  Fly   976 AAKSRSRVEDPEQAKMKARAKEMQRAEMEELRQRDANLTALQAIGPRKKLKLDGETVSSGAGSSG 1040

  Fly   194 SKVAKLTG-APIQRACAPRFKHMNIRDVLQFMEEDRRYARSNMLFEAYLK 242
            ..|...:| ||  ....||.|.:|:||:|.:||::|.:.||:|||:.|||
  Fly  1041 GGVLSSSGSAP--TTLRPRIKRVNLRDMLFYMEQEREFCRSSMLFKTYLK 1088

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nhtNP_523574.4 TAF4 10..238 CDD:173965 52/175 (30%)
Taf4NP_001137958.1 TAFH 460..550 CDD:197785
TAF4 842..1084 CDD:283017 52/175 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2341
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001222
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR15138
RoundUp 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.