DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nht and Taf4

DIOPT Version :10

Sequence 1:NP_523574.4 Gene:nht / 34902 FlyBaseID:FBgn0041103 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001137958.1 Gene:Taf4 / 39765 FlyBaseID:FBgn0010280 Length:1088 Species:Drosophila melanogaster


Alignment Length:180 Identity:55/180 - (30%)
Similarity:83/180 - (46%) Gaps:26/180 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 ALETYMKHVVKKTIELCEHRTSYHLHNDERCVMKNDMRVTMMFLNDLEIADYGS----------- 139
            |.:..:|::|:|...:.|||... :..|.|.....|:|..:.||.:|:.|:...           
  Fly   912 ACQERLKNIVEKLAVIAEHRIDV-IKLDPRYEPAKDVRGQIKFLEELDKAEQKRHEELEREMLLR 975

  Fly   140 --------SDDETGFYRKRRAENIDEERKVARLESVNDTALLAISGRKR---PGEQLAPESAPSG 193
                    .|.|....:.|..|....|.:..|....|.|||.||..||:   .||.::..:..||
  Fly   976 AAKSRSRVEDPEQAKMKARAKEMQRAEMEELRQRDANLTALQAIGPRKKLKLDGETVSSGAGSSG 1040

  Fly   194 SKVAKLTG-APIQRACAPRFKHMNIRDVLQFMEEDRRYARSNMLFEAYLK 242
            ..|...:| ||  ....||.|.:|:||:|.:||::|.:.||:|||:.|||
  Fly  1041 GGVLSSSGSAP--TTLRPRIKRVNLRDMLFYMEQEREFCRSSMLFKTYLK 1088

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nhtNP_523574.4 TAF4 <85..237 CDD:461598 50/173 (29%)
Taf4NP_001137958.1 TAFH 460..550 CDD:197785
PHA03378 <500..>742 CDD:223065
TAF4 842..1084 CDD:461598 51/174 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.