DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nht and Taf4b

DIOPT Version :9

Sequence 1:NP_523574.4 Gene:nht / 34902 FlyBaseID:FBgn0041103 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_006254501.1 Gene:Taf4b / 291773 RGDID:1562997 Length:852 Species:Rattus norvegicus


Alignment Length:218 Identity:51/218 - (23%)
Similarity:96/218 - (44%) Gaps:42/218 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SIYKKIM----KHLSQGNQADDINISEQEWLLDSFLAALETYMKHVVKKTIELCEHRTSYHLHND 113
            ::.|:|:    ||......:|.:|:...         |.:..::.:::|...:.:||.:.: ...
  Rat   649 ALQKRILDIGKKHDITELNSDAVNLISH---------ATQERLRGLLEKLTAIAQHRMTIY-KGS 703

  Fly   114 ERCVMKNDMRVTMMFL----------NDLEIADY--------GSSDDETGFYRKRRAENIDEERK 160
            |..::..|.|..:.||          .|||..:.        .:.:|......|::|:.: ::.:
  Rat   704 ENYILSTDTRSQLKFLEKLDQLEKQRKDLEEREMLLKAAKSRSNKEDPEQLRLKQKAKEL-QQLE 767

  Fly   161 VARLE--SVNDTALLAISGRKRPGEQLAPES---APSGSKVAKLTGA-PIQRACAPRFKHMNIRD 219
            :|:::  ..|.|||.||..||:...:...||   .||.|....||.. |:.|   ||...:::||
  Rat   768 LAQIQYRDANLTALAAIGPRKKRPLESGNESFKDNPSASGTCSLTATRPLLR---PRITRVSLRD 829

  Fly   220 VLQFMEEDRRYARSNMLFEAYLK 242
            ::..||::|....|..|:.|.||
  Rat   830 LIFCMEQERGMKYSRALYLALLK 852

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nhtNP_523574.4 TAF4 10..238 CDD:173965 48/212 (23%)
Taf4bXP_006254501.1 TAFH 257..345 CDD:284862
TAF4 606..847 CDD:283017 47/211 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2341
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001841
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15138
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.