DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nht and taf4

Sequence 1:NP_523574.4 Gene:nht FlyBaseID:FBgn0041103 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_593109.1 Gene:taf4 PomBaseID:SPAC23G3.09 Length:365 Species:Schizosaccharomyces pombe

Alignment Length:298 Identity:67/299 (22%)
Similarity:114/299 (38%) Gaps:99/299 (33%)


  Fly    31 QDA-SKAKVSIKK---NQRASFFDRSSIYKKIMKHLSQGNQADDIN-------ISEQEWL----- 79
            ||| ....:.:|:   |...||:|.||:....:....:..::|.:|       :|....|     
pombe    82 QDALISCGIQLKEEELNLSTSFYDPSSLNTFALTTEDRSRKSDFLNSFVLMQTVSNIVNLHRLKS 146

  Fly    80 LDSFLAAL-----ETYMKHVVKKTIELCEHRTSYHLHNDE-------RCVMKN---------DMR 123
            :||.:.||     ..|:.::::|.|....|||| .||.|.       |..:.|         :.|
pombe   147 MDSDIHALISMAVRDYLANLLQKMIVESHHRTS-QLHTDNYKQVDNVRQTLANFAYKEYESEERR 210

  Fly   124 VTMMFL----NDLEIADYGS-SDDETGFYRKRR-------AENIDEERKVARLESVNDTALLAIS 176
            .|::.:    ::..:|:..| |.:|.|..|:|:       |:||.|:   |:....|.||.:   
pombe   211 RTVLNIRRAEHEARLAELNSASTNEEGSSRRRKEQSSSAAAKNISED---AQNRMTNATASI--- 269

  Fly   177 GRKRPGEQLAPESAPSGSK--------VAKLT-----GAPIQRACAPRFKH-------------- 214
                    :|..:.|||.|        :..:|     |..|::..:...|.              
pombe   270 --------MAGSALPSGGKKYSWMATDMTPMTPAVGGGFGIRKKDSNSLKPSSRDGVLPLQQEEK 326

  Fly   215 --MNIRDVLQFMEEDRRYA------RSNMLFEAYLKYK 244
              :.|||.|..:|.||..|      .:..:..||::.|
pombe   327 GIITIRDALAVLEMDREGAGRIFGRGAKAMMRAYIRLK 364

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nhtNP_523574.4 TAF4 10..238 CDD:173965 64/291 (22%)
taf4NP_593109.1 TAF4 81..360 CDD:283017 65/293 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001222
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR15138
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.