DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nht and taf-4

Sequence 1:NP_523574.4 Gene:nht FlyBaseID:FBgn0041103 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_490728.2 Gene:taf-4 WormBaseID:WBGene00006385 Length:523 Species:Caenorhabditis elegans

Alignment Length:212 Identity:42/213 (20%)
Similarity:78/213 (37%) Gaps:59/213 (28%)


  Fly    45 RASFFDRSSIYKKIMKHLSQGNQADDINISEQEWLLDSFLAALETYMKHVVKKTIELCEHRTSYH 109
            ::|......:..:|.|.:..       :.|.:|..|.:...|:|::::.::.....:.|||.. .
 Worm   325 KSSILKPDEVLNRITKRMMS-------SCSVEEEALVAISDAVESHLRELITLMAGVAEHRVE-S 381

  Fly   110 LHNDERCVMKNDMRVTMMFLNDLEIADYGSSDDETGFYRKRRAENIDEERKVARLESVNDTALLA 174
            |...|..|..:|::..:.||.||:                |:.|.:.|.|:        ..:|:.
 Worm   382 LRIPENYVAIDDVKRQLRFLEDLD----------------RQEEELRESRE--------KESLIR 422

  Fly   175 ISGRKRPGEQ----------------------LAPESAPSGSKVAK----LTGAPIQRACAPRFK 213
            :|..|..|::                      .|..:|.|.:|..|    .||| ...|..||..
 Worm   423 MSKNKNSGKETIEKAKEMQRQDAEAKRNRDANAAAIAALSSNKTVKNKWENTGA-ATTAPRPRTV 486

  Fly   214 HMNIRDVLQFMEEDRRY 230
            .:..||:...:.:|.|:
 Worm   487 RVTTRDLHLLVNQDSRF 503

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nhtNP_523574.4 TAF4 10..238 CDD:173965 42/213 (20%)
taf-4NP_490728.2 TAFH 103..196 CDD:197785
TAF4 299..509 CDD:173965 42/213 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2341
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001222
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR15138
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.