DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nht and LOC101886077

Sequence 1:NP_523574.4 Gene:nht FlyBaseID:FBgn0041103 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_009299300.2 Gene:LOC101886077 ID: Length:252 Species:Danio rerio

Alignment Length:194 Identity:39/195 (20%)
Similarity:80/195 (41%) Gaps:40/195 (21%)


  Fly     8 VPIQPYAGQLLIIN-DLILPDSGSQDASKAKVSIKKNQRASFFDRSSIYKKIMKHLSQGNQADDI 71
            |.:...:.::|..| ||:    |:|        |:..:..:|.....::::|::      .|...
Zfish    77 VNLNEESARILATNSDLV----GTQ--------IRSCKDEAFLPIGLLHRRILE------TAKRF 123

  Fly    72 NISEQEWLLDSFLA-ALETYMKHVVKKTIELCEHRTSYHLHNDERCVMKNDMRVTMMFLNDLEIA 135
            .:::......:|:: |.::.::.|::|...:.:||.. ....||.|...:|:|..:.|...||..
Zfish   124 GVTDVPLEAVNFISHATQSRLRTVLEKVSSIAQHRMD-SCKEDEWCEPSSDVRAQLKFFEQLERM 187

  Fly   136 DYGSSDDETG--FYRKRRAENIDEERKVARLE-----------------SVNDTALLAISGRKR 180
            :....|:...  ..|..::.:..|:.:.|||:                 ..|.|||.||..||:
Zfish   188 EKQRKDEREREILLRAAKSRSRQEDPEQARLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKK 251

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nhtNP_523574.4 TAF4 10..238 CDD:173965 38/193 (20%)
LOC101886077XP_009299300.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001222
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.