DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nht and taf4b

Sequence 1:NP_523574.4 Gene:nht FlyBaseID:FBgn0041103 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_002940973.2 Gene:taf4b XenbaseID:XB-GENE-995003 Length:892 Species:Xenopus tropicalis

Alignment Length:224 Identity:51/225 (23%)
Similarity:97/225 (43%) Gaps:43/225 (19%)


  Fly    48 FFDRSSIYKKIM----KHLSQGNQADDINISEQEWLLDSFLAALETYMKHVVKKTIELCEHRTSY 108
            |...|::..:|:    :|..:...:|.:|:...         |.:..::.:::|.....:||::.
 Frog   683 FLFTSALQNRILDIGKRHDIKELNSDVMNLVSH---------ATQERLRGLIEKLTLAAQHRSTN 738

  Fly   109 HLHNDERCVMKNDMRVTMMFLNDLE------------------IADYGSSDDETGFYRKRRAENI 155
            :..:| |.:..:|:|..:.||..||                  .....:.:|......|::|:.:
 Frog   739 YKQSD-RYLKYSDVRAQLKFLEQLEHLEKQRRNEEEREMLLRAAKSRSNREDPEQLRLKQKAKEL 802

  Fly   156 DE-ERKVARLESVNDTALLAISGR-KRPGEQLA-----PESAPSGSKVAKLTGAPIQRACAPRFK 213
            .: |.:..:....|.|||.||..| |||.:.|.     .|:.||||.:..|:    :....||..
 Frog   803 QQMELEQIQYREANLTALAAIGPRKKRPLDSLCLHNGWDETIPSGSTIFGLS----KSLLVPRIT 863

  Fly   214 HMNIRDVLQFMEEDRRYARSNMLFEAYLK 242
            .:::||::..||::|....|..|:.|.||
 Frog   864 RVSLRDLIFCMEQERESKHSLSLYRALLK 892

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nhtNP_523574.4 TAF4 10..238 CDD:173965 48/219 (22%)
taf4bXP_002940973.2 TAFH 416..504 CDD:284862
TAF4 645..889 CDD:283017 48/220 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001222
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.