DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nht and taf4b

DIOPT Version :9

Sequence 1:NP_523574.4 Gene:nht / 34902 FlyBaseID:FBgn0041103 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_017208212.2 Gene:taf4b / 100150678 ZFINID:ZDB-GENE-070424-105 Length:833 Species:Danio rerio


Alignment Length:314 Identity:69/314 - (21%)
Similarity:112/314 - (35%) Gaps:120/314 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SQDASKAKVSIKKNQRASFFDRSSIYKKIMKHLSQ---------------GNQADD--------- 70
            ||..||..|............|.||.:....|.||               |:..||         
Zfish   537 SQTQSKQMVIQTSTHSTGAVVRQSILQASKTHFSQPTLPAQAHSFKDSTSGSFRDDDDINDVASM 601

  Fly    71 --INISEQ--------EWLLDS-----------FLAALETYMKHV-------------------- 94
              :|:||:        ..|:.|           |.:||:|.:.|:                    
Zfish   602 AGVNLSEENARILASGSELVGSVIRSCQEEPFLFPSALQTRVLHIGGSLGVTEVCPDVLELISLA 666

  Fly    95 --------VKKTIELCEHR-TSYHLHNDERCVMKNDMRVTMMFLNDLE----------------- 133
                    ::|...:.:|| .||  .:|.|....||.|..:.||..||                 
Zfish   667 TQERLRDLLEKITAVAQHRQISY--RDDWRYTQTNDTRSQLKFLEQLERLEKQKREEEERETLLR 729

  Fly   134 IADYGSSDDETGFYR-KRRAENIDEERKVARLE--SVNDTALLAISGRKRPGEQLAPESAPSGSK 195
            ||...|:.::....| |:||:.: ::.::|::|  ..|..||.|:..||:     .|..|| |..
Zfish   730 IARSRSNSEDPEQQRLKQRAKEM-QQLELAQMEHRDANLAALAALGPRKK-----KPLEAP-GLG 787

  Fly   196 VAKLTG--------APIQRACAPRFKHMNIRDVLQFMEEDRRYARSNMLFEAYL 241
            ..:|.|        ||::         :.:||:..:||:|..:..:.:|:.|:|
Zfish   788 ANQLLGSHGHFASRAPVR---------VTMRDLTFYMEQDPTFRHTLVLYRAFL 832

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nhtNP_523574.4 TAF4 10..238 CDD:173965 67/309 (22%)
taf4bXP_017208212.2 Atrophin-1 <136..391 CDD:331285
TAFH 395..481 CDD:311467
TAF4 595..830 CDD:310095 53/252 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2341
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001841
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15138
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.