| Sequence 1: | NP_523574.4 | Gene: | nht / 34902 | FlyBaseID: | FBgn0041103 | Length: | 245 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_005172945.2 | Gene: | taf4a / 100149942 | ZFINID: | ZDB-GENE-131127-579 | Length: | 821 | Species: | Danio rerio |
| Alignment Length: | 245 | Identity: | 46/245 - (18%) |
|---|---|---|---|
| Similarity: | 83/245 - (33%) | Gaps: | 75/245 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 71 INISEQEWLL-----------------DSFLAALETYMKHVV-------------KKTIELCEHR 105
Fly 106 TSYHLHN------------------DERCVMKNDMRVTMMFLNDLE------------------I 134
Fly 135 ADYGSSDDETGFYRKRRAENI-DEERKVARLESVNDTALLAISGRKR---PGEQLAPESAPSG-- 193
Fly 194 -SKVAKLTGAPIQRACAPRFKHMNIRDVLQFMEEDRRYARSNMLFEAYLK 242 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| nht | NP_523574.4 | TAF4 | 10..238 | CDD:173965 | 43/239 (18%) |
| taf4a | XP_005172945.2 | None | |||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG2341 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0001841 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR15138 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 3.000 | |||||