DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nht and taf4a

DIOPT Version :9

Sequence 1:NP_523574.4 Gene:nht / 34902 FlyBaseID:FBgn0041103 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_005172945.2 Gene:taf4a / 100149942 ZFINID:ZDB-GENE-131127-579 Length:821 Species:Danio rerio


Alignment Length:245 Identity:46/245 - (18%)
Similarity:83/245 - (33%) Gaps:75/245 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 INISEQEWLL-----------------DSFLAALETYMKHVV-------------KKTIELCEHR 105
            :|:||:...:                 ::||:|  :.::|.:             .:.:.:..|.
Zfish   579 VNLSEESARILATNSELVGAVTRSCKDEAFLSA--SMLQHKILEIGQRFGVTDLGPEVVNIVSHA 641

  Fly   106 TSYHLHN------------------DERCVMKNDMRVTMMFLNDLE------------------I 134
            |...|.|                  |.|.....|:|..:.|...|:                  .
Zfish   642 TQQRLQNLLEKVSLIAQQKNMTYKEDSRYEQVEDVRAQLKFFEQLDQLEKQKKEEQEREILMKAA 706

  Fly   135 ADYGSSDDETGFYRKRRAENI-DEERKVARLESVNDTALLAISGRKR---PGEQLAPESAPSG-- 193
            ......:|......|::|:.: .:|....|....|.|||.||..||:   ....|..::..||  
Zfish   707 KSRSRQEDPEQLRLKQKAKEMQQQELAQIRQRDANLTALAAIGPRKKRKPDSPSLGIDTEGSGLC 771

  Fly   194 -SKVAKLTGAPIQRACAPRFKHMNIRDVLQFMEEDRRYARSNMLFEAYLK 242
             |....|.....::....|...:|:||:|..:|.::..:.|.:|:.|.||
Zfish   772 ASASGGLNAGASRQFTRQRITRVNLRDLLFCLENEKSTSHSQLLYRALLK 821

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nhtNP_523574.4 TAF4 10..238 CDD:173965 43/239 (18%)
taf4aXP_005172945.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2341
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001841
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15138
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.