Sequence 1: | NP_523574.4 | Gene: | nht / 34902 | FlyBaseID: | FBgn0041103 | Length: | 245 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005172945.2 | Gene: | taf4a / 100149942 | ZFINID: | ZDB-GENE-131127-579 | Length: | 821 | Species: | Danio rerio |
Alignment Length: | 245 | Identity: | 46/245 - (18%) |
---|---|---|---|
Similarity: | 83/245 - (33%) | Gaps: | 75/245 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 71 INISEQEWLL-----------------DSFLAALETYMKHVV-------------KKTIELCEHR 105
Fly 106 TSYHLHN------------------DERCVMKNDMRVTMMFLNDLE------------------I 134
Fly 135 ADYGSSDDETGFYRKRRAENI-DEERKVARLESVNDTALLAISGRKR---PGEQLAPESAPSG-- 193
Fly 194 -SKVAKLTGAPIQRACAPRFKHMNIRDVLQFMEEDRRYARSNMLFEAYLK 242 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
nht | NP_523574.4 | TAF4 | 10..238 | CDD:173965 | 43/239 (18%) |
taf4a | XP_005172945.2 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2341 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0001841 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR15138 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.000 |