DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15262 and CDC36

DIOPT Version :9

Sequence 1:NP_609750.1 Gene:CG15262 / 34901 FlyBaseID:FBgn0028852 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_010116.1 Gene:CDC36 / 851389 SGDID:S000002324 Length:191 Species:Saccharomyces cerevisiae


Alignment Length:195 Identity:50/195 - (25%)
Similarity:72/195 - (36%) Gaps:50/195 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 GMPLGGVTFELGSPTN-------ETTSNVEAKPSGSTIQGAFGMLGLAKKLRSINQNPLLFGNNV 284
            |..|..:.:.||.|.:       :|..:..|:.|.|.::                  |..|....
Yeast    31 GADLSSMLYSLGIPRDSQDHRVLDTFQSPWAETSRSEVE------------------PRFFTPES 77

  Fly   285 AHNIGGAADSIFTGPIQEARLTPQEMSYKLPLNYLFNVNMSLQ--EPKIEEMHDELLFFFFYTYA 347
            ..||.|...|..|.|                   .||   |:|  :.::....||.|||.||.:.
Yeast    78 FTNIPGVLQSTVTPP-------------------CFN---SIQNDQQRVALFQDETLFFLFYKHP 120

  Fly   348 GDMMQMLAAAELAERGWRYHKYEHFWVIRQ-ADNPNYLYHGFREFGEYNYFNMWQWKILPRHFYL 411
            |.::|.|...||.:|.|||||....|:.:. ...|.....|..|.|.|.:|:..:|:...|.|.|
Yeast   121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQRDFLL 185

  Fly   412  411
            Yeast   186  185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15262NP_609750.1 NOT2_3_5 294..414 CDD:282064 36/121 (30%)
CDC36NP_010116.1 CDC36 5..191 CDD:227888 50/195 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I2346
eggNOG 1 0.900 - - E1_COG5601
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2523
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003536
OrthoInspector 1 1.000 - - otm46526
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23326
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2209
SonicParanoid 1 1.000 - - X2412
TreeFam 00.000 Not matched by this tool.
98.890

Return to query results.
Submit another query.