DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15262 and CDC36

Sequence 1:NP_609750.1 Gene:CG15262 FlyBaseID:FBgn0028852 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_010116.1 Gene:CDC36 SGDID:S000002324 Length:191 Species:Saccharomyces cerevisiae

Alignment Length:195 Identity:50/196 (26%)
Similarity:72/196 (37%) Gaps:50/196 (26%)


  Fly   227 GMPLGGVTFELGSPTN-------ETTSNVEAKPSGSTIQGAFGMLGLAKKLRSINQNPLLFGNNV 284
            |..|..:.:.||.|.:       :|..:..|:.|.|.::                  |..|....
Yeast    31 GADLSSMLYSLGIPRDSQDHRVLDTFQSPWAETSRSEVE------------------PRFFTPES 77

  Fly   285 AHNIGGAADSIFTGPIQEARLTPQEMSYKLPLNYLFNVNMSLQ--EPKIEEMHDELLFFFFYTYA 347
            ..||.|...|..|.|                   .||   |:|  :.::....||.|||.||.:.
Yeast    78 FTNIPGVLQSTVTPP-------------------CFN---SIQNDQQRVALFQDETLFFLFYKHP 120

  Fly   348 GDMMQMLAAAELAERGWRYHKYEHFWVIRQ-ADNPNYLYHGFREFGEYNYFNMWQWKILPRHFYL 411
            |.::|.|...||.:|.|||||....|:.:. ...|.....|..|.|.|.:|:..:|:...|.|.|
Yeast   121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQRDFLL 185

  Fly   412  411
            Yeast   186  185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15262NP_609750.1 NOT2_3_5 294..414 CDD:282064 36/122 (30%)
CDC36NP_010116.1 CDC36 5..191 CDD:227888 50/196 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5601
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S2523
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003118
OrthoInspector 1 1.000 T634723
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23326
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2209
TreeFam 00.000 Not matched by this tool.
65.980

Return to query results.
Submit another query.