| Sequence 1: | NP_609750.1 | Gene: | CG15262 / 34901 | FlyBaseID: | FBgn0028852 | Length: | 438 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001077478.1 | Gene: | AT1G07705 / 837284 | AraportID: | AT1G07705 | Length: | 614 | Species: | Arabidopsis thaliana |
| Alignment Length: | 416 | Identity: | 93/416 - (22%) |
|---|---|---|---|
| Similarity: | 158/416 - (37%) | Gaps: | 93/416 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 49 DVVKNKPKQELPPSASPSQ--------------PLA---PEFSIFREDFPALPGSLPSALPTALP 96
Fly 97 TTSSPVVPDDWTAMMSNSEQVELAKFRNTVIRNSSDPC-------VNANGNEVLRQPTHAPEKRQ 154
Fly 155 NMELLPHMYGYLGNPFRLNLSMIFTKQFL--------LEGVRQRAINAAHKRAALA--KPAIQPP 209
Fly 210 PGFENCKIFARLITNSDGMPLGGVTFELGSPTNETTSNVEAKPSGSTIQGAFGMLGLAKKLR--- 271
Fly 272 --------SINQNPLLFGNNVAHNIGGAADSIFTGPIQEARLTPQEMSYKLPLNYLFNVNMSLQE 328
Fly 329 PKIEEMHDELLFFFFYTYAGDMMQMLAAAELAERGWRYHKYEHFWVIRQADNPNYLYHGFREFGE 393
Fly 394 YNYFNMWQWKILPR-HFYLDPEILER 418 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG15262 | NP_609750.1 | NOT2_3_5 | 294..414 | CDD:282064 | 33/120 (28%) |
| AT1G07705 | NP_001077478.1 | LbetaH | <116..>174 | CDD:294107 | |
| NOT2_3_5 | 481..600 | CDD:282064 | 33/125 (26%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 1 | 1.000 | 72 | 1.000 | Domainoid score | I3306 |
| eggNOG | 1 | 0.900 | - | - | E1_COG5601 | |
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1273874at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0003536 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR23326 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X2412 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| 8 | 7.970 | |||||