DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15262 and AT1G07705

Sequence 1:NP_609750.1 Gene:CG15262 FlyBaseID:FBgn0028852 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001077478.1 Gene:AT1G07705 AraportID:AT1G07705 Length:614 Species:Arabidopsis thaliana

Alignment Length:416 Identity:93/417 (22%)
Similarity:158/417 (38%) Gaps:93/417 (22%)


  Fly    49 DVVKNKPKQELPPSASPSQ--------------PLA---PEFSIFREDFPALPGSLPSALPTALP 96
            |:..:.|:....||::.||              |:.   .||||..||||||||...|:.     
plant   236 DINNDFPQLTSRPSSAGSQGQLGSRLKQGLGISPIVQQNQEFSIQNEDFPALPGYKGSSA----- 295

  Fly    97 TTSSPVVPDDWTAMMSNSEQVELAKFRNTVIRNSSDPC-------VNANGNEVLRQPTHAPEKRQ 154
                     |:...:.:.||:.    .|:|:...|...       .|..|    ...:|.|:::|
plant   296 ---------DYPMDLHHKEQLH----ENSVLMMQSQQLSMGRSGGFNLGG----AYTSHRPQQQQ 343

  Fly   155 NMELLPHMYGYLGNPFRLNLSMIFTKQFL--------LEGVRQRAINAAHKRAALA--KPAIQPP 209
            .     |......:...|:.|.||:....        ..|:..|::|:|:....:.  :..||..
plant   344 Q-----HAQAVSSSGVSLHGSDIFSSSHPPYHSQTGGAPGIGLRSMNSANSITGMGYDQQLIQQY 403

  Fly   210 PGFENCKIFARLITNSDGMPLGGVTFELGSPTNETTSNVEAKPSGSTIQGAFGMLGLAKKLR--- 271
            ...:|...:.....::...|...|..:   ....|.||.:          .||:|||...::   
plant   404 QHQQNSAQYRLQQMSAASQPFRDVGLK---SMQSTQSNPD----------RFGLLGLLSVIKMSD 455

  Fly   272 --------SINQNPLLFGNNVAHNIGGAADSIFTGPIQEARLTPQEMSYKLPLNYLFNVNMSLQE 328
                    .|:...|....|...|:.....|.::.  :.:::.|:   :.:|..|.......|.:
plant   456 PDLTSLALGIDLTTLGLNLNSTENLHKTFGSPWSN--EPSKVDPE---FSVPQCYYAKNPPPLHQ 515

  Fly   329 PKIEEMHDELLFFFFYTYAGDMMQMLAAAELAERGWRYHKYEHFWVIRQADNPNYLYHGFREFGE 393
            ....::..|.||:.||:...|..|:.||.||..|||.|||....|.||..: |....:.: |.|.
plant   516 GLFAKLLVETLFYVFYSMPKDEAQLYAANELYNRGWFYHKEHRLWFIRIGE-PLVKTNAY-ERGS 578

  Fly   394 YNYFNMWQWKILPR-HFYLDPEILER 418
            |:.|:...::|:.: :|.|..|:||:
plant   579 YHCFDPNSFEIVQKENFVLYYEMLEK 604

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15262NP_609750.1 NOT2_3_5 294..414 CDD:282064 33/121 (27%)
AT1G07705NP_001077478.1 LbetaH <116..>174 CDD:294107
NOT2_3_5 481..600 CDD:282064 33/126 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1273874at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23326
Phylome 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.