DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15262 and VIP2

Sequence 1:NP_609750.1 Gene:CG15262 FlyBaseID:FBgn0028852 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001329954.1 Gene:VIP2 AraportID:AT5G59710 Length:614 Species:Arabidopsis thaliana

Alignment Length:373 Identity:84/374 (22%)
Similarity:134/374 (36%) Gaps:85/374 (23%)


  Fly    72 EFSIFREDFPALPGSLPSALPTALPTTSSPVVPDDWTAMMSNSEQVELAKFRNTVIRNSSDPCVN 136
            ||||..||||||||.........:.......:.|:..:|| :|:...:.:              :
plant   308 EFSIQNEDFPALPGYKGGNSEYPMDLHQKEQLHDNAMSMM-HSQNFSMGR--------------S 357

  Fly   137 ANGNEVLRQPTHAPEKRQNMELLPHMYGYLGNPFRLNLSMIFTKQFLLEGVRQRAINAAHKRAAL 201
            ...|......:|.|:::      |......|.               |:|:..|.:::.:..:::
plant   358 GGFNLGATYSSHRPQQQ------PQHTSSTGG---------------LQGLGLRPLSSPNAVSSI 401

  Fly   202 AKPAIQPPPGFENCKIFARLITNSDGMP---LGGVTFELGSPTNETTSNVEAKPSGSTIQGAFGM 263
                     |::......:...|....|   :..:.....|....|.|  ||.|        |.:
plant   402 ---------GYDQLIQQYQQHQNQSQFPVQQMSSINQFRDSEMKSTQS--EADP--------FCL 447

  Fly   264 LGLAKKLRSINQNP----LLFGNNVAHNIGGAADSIFTGPIQEARLTP-------QEMSYKLPLN 317
            |||...|.  ..||    |..|.::. .:|  .|...||.:.:...:|       .|:.:.:|..
plant   448 LGLLDVLN--RSNPELTSLALGIDLT-TLG--LDLNSTGNLYKTFASPWTNEPAKSEVEFTVPNC 507

  Fly   318 YLFNVNMSLQEPKIEEMHDELLFFFFYTYAGDMMQMLAAAELAERGWRYHKYEHFWVIRQAD--- 379
            |.......|.....:....||||:.||:...|..|:.||.||.||||.|||....|..|..:   
plant   508 YYATEPPPLTRASFKRFSYELLFYTFYSMPKDEAQLYAADELYERGWFYHKELRVWFFRVGEPLV 572

  Fly   380 -NPNYLYHGFREFGEYNYFNMWQWK-ILPRHFYLDPEILERTLSKEEL 425
             ...|      |.|.|.|.:...:| :...||.:..|::|:..|..:|
plant   573 RAATY------ERGTYEYLDPNSFKTVRKEHFVIKYELMEKRPSLLQL 614

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15262NP_609750.1 NOT2_3_5 294..414 CDD:282064 36/132 (27%)
VIP2NP_001329954.1 NOT2_3_5 484..603 CDD:282064 34/125 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1273874at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23326
Phylome 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.