DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15262 and CNOT2

Sequence 1:NP_609750.1 Gene:CG15262 FlyBaseID:FBgn0028852 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001186231.1 Gene:CNOT2 HGNCID:7878 Length:540 Species:Homo sapiens

Alignment Length:449 Identity:99/450 (22%)
Similarity:164/450 (36%) Gaps:174/450 (39%)


  Fly    11 DQQEVESSPSPPPPPPFQSPLSSPESLQTPDGYPILYVDVVKNKPKQELPPSASPSQPLAPEFSI 75
            |:...|.|.:|       :||.:|.:.:.|      ||.:|           ..|:...:.:|||
Human   235 DRNRREGSGNP-------TPLINPLAGRAP------YVGMV-----------TKPANEQSQDFSI 275

  Fly    76 FREDFPALPGS-----------LPSALPTALPTTSS---PVVPDDWTAMMSNSEQVELAKFRNTV 126
            ..|||||||||           ..|.|.|:..||||   |..|.|.::...|:.|          
Human   276 HNEDFPALPGSSYKDPTSSNDDSKSNLNTSGKTTSSTDGPKFPGDKSSTTQNNNQ---------- 330

  Fly   127 IRNSSDPCVNANGNEVLRQPTHAPEKRQNMELLPHMYGYLGNPFRLNLSMIFTKQFLLEGVRQRA 191
                                     :::.:::||                        :|     
Human   331 -------------------------QKKGIQVLP------------------------DG----- 341

  Fly   192 INAAHKRAALAKPAIQPPPGFENCKIFARLITNSDGMPLGGVTFELGSPTNETTSNVEAKPSGST 256
                                         .:||   :|.|.||.:                    
Human   342 -----------------------------RVTN---IPQGMVTDQ-------------------- 354

  Fly   257 IQGAFGMLGLAKKLRSINQNP----LLFGNNVAHNIG---GAADSI---FTGPIQEARLTPQEMS 311
                |||:||...:|:...:|    |..|:::. .:|   .:.:::   |..|...:...||::.
Human   355 ----FGMIGLLTFIRAAETDPGMVHLALGSDLT-TLGLNLNSPENLYPKFASPWASSPCRPQDID 414

  Fly   312 YKLPLNYLFNVNM--SLQEPKIEEMHDELLFFFFYTYAGDMMQMLAAAELAERGWRYHKYEHFWV 374
            :.:|..||.|:::  .|...|:....::|||:.:|...||::|:|||.||..|.|||||.|..|:
Human   415 FHVPSEYLTNIHIRDKLAAIKLGRYGEDLLFYLYYMNGGDVLQLLAAVELFNRDWRYHKEERVWI 479

  Fly   375 IRQADNPNYLYHGFREFGEYNYFNMWQWKILPRHFYLDPEILERTLSKEELYVTYGYHP 433
            .|.......:.....|.|.|.:|:...|:.:.:.|:|:.:.||   .:..|..|:.|:|
Human   480 TRAPGMEPTMKTNTYERGTYYFFDCLNWRKVAKEFHLEYDKLE---ERPHLPSTFNYNP 535

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15262NP_609750.1 NOT2_3_5 294..414 CDD:282064 38/125 (30%)
CNOT2NP_001186231.1 NOT2_3_5 396..519 CDD:335639 38/123 (31%)
Repressor domain 437..540 34/103 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C224954056
eggNOG 1 0.900 E1_COG5601
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S2523
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1273874at2759
OrthoFinder 1 1.000 FOG0003118
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23326
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2209
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.790

Return to query results.
Submit another query.