DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15262 and Rga

Sequence 1:NP_609750.1 Gene:CG15262 FlyBaseID:FBgn0028852 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_730966.1 Gene:Rga FlyBaseID:FBgn0017550 Length:585 Species:Drosophila melanogaster

Alignment Length:484 Identity:120/485 (25%)
Similarity:182/485 (38%) Gaps:157/485 (32%)


  Fly    29 SPLSSPESLQTPDGYPILY-------VDVVKNKPKQELPPSASP-----------SQPLA--PEF 73
            |..|:| :|..|..:|.|.       ..:.::.|.|  ||.:.|           .||.:  .||
  Fly   152 SDTSTP-ALLDPTEFPSLTNARGQNDQTLPQSNPLQ--PPGSKPYGNFFTSFGMVKQPTSEQSEF 213

  Fly    74 SIFREDFPALPGSLPS-----ALPTALPTTSSPVVPD----DWTAMMSNSEQVELAKFRNTVIRN 129
            ::..||||||||:..|     |:.:...|..|.....    |.|....||          .|:..
  Fly   214 TMSNEDFPALPGTQNSDGTTNAVGSVAGTGGSGGASTENHLDGTEKPMNS----------IVVSG 268

  Fly   130 SSDPCVNAN-----GNEVLRQPTHAPEKRQNMELLPHMYGYLGNPFRLNLSMIFTKQFLLEGVRQ 189
            |:.....:|     ||.:                     |.:|:                 |:..
  Fly   269 SASGSSGSNVGVVGGNGL---------------------GAVGS-----------------GIGG 295

  Fly   190 RAI----------------NAA-------HKRAALAKPAIQPPPGFENCKIFARLITNSDGMPLG 231
            .|:                |||       |.....:...|    |..|.      :.||:.|.  
  Fly   296 LAVGGGGGAGSSGGGGVGGNAASGVVGGSHVGLVGSNSGI----GGVNS------VPNSNAMM-- 348

  Fly   232 GVTFELGSPT------------NETTSN-------VEAKPSG-------STIQGAFGMLGLAKKL 270
            ||...|||.:            |:.:||       |:..|.|       :.:...|||:||...:
  Fly   349 GVGGGLGSGSGSSGSGAGGEHLNDNSSNDKLVKSGVQTSPDGKVTNIPATMVNNQFGMVGLLTFI 413

  Fly   271 RSINQNPLLFGNNVAHNIGG---------AADSIFTGPIQEARLTPQEMSYKLPLNYLFN--VNM 324
            |:...:|.|...::..::.|         :..:.|.||........|::.:.:|..||.|  :..
  Fly   414 RAAETDPNLVTLSLGTDLTGLGLNLNSQESLHTTFAGPFVAQPCRAQDVEFNVPPEYLINFAIRD 478

  Fly   325 SLQEPKIEEMHDELLFFFFYTYAGDMMQMLAAAELAERGWRYHKYEHFWVIRQADNPNYLYHGFR 389
            .|..|.::::.::||||.|||..|||||::|||||..|.||||..|..|:.|......|..:|.:
  Fly   479 KLTAPVLKKLQEDLLFFLFYTNIGDMMQLMAAAELHSREWRYHVEEKIWITRIPGIDQYEKNGTK 543

  Fly   390 EFGEYNYFNMWQWKILPRHFYLDPEILER 418
            |.|.:.||:...||.|.:.|.:|||.|::
  Fly   544 ERGTFYYFDAQSWKRLSKVFQIDPEKLDK 572

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15262NP_609750.1 NOT2_3_5 294..414 CDD:282064 47/122 (39%)
RgaNP_730966.1 NOT2_3_5 445..568 CDD:282064 47/123 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C224934538
eggNOG 1 0.900 E1_COG5601
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S2523
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23326
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2209
65.910

Return to query results.
Submit another query.