DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15262 and CG6576

DIOPT Version :9

Sequence 1:NP_609750.1 Gene:CG15262 / 34901 FlyBaseID:FBgn0028852 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_648253.1 Gene:CG6576 / 39003 FlyBaseID:FBgn0035924 Length:267 Species:Drosophila melanogaster


Alignment Length:216 Identity:42/216 - (19%)
Similarity:72/216 - (33%) Gaps:66/216 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 RLNLSMIFTKQFLLEGVRQRAINAAHKRAALAKPAIQPPPGFE----------------NCKIFA 219
            ::|.|:...|:      :|....:|.|......|.:..||..|                :.|:|.
  Fly    10 KVNPSIALRKK------KQETAPSAEKVEPQRPPPLPDPPSEEPPEVVSTSSVESEIESDYKLFP 68

  Fly   220 RLITNSDGMP-----LGGVTFE----------LGSPTNETTSNVEAKPSG-------STIQGAFG 262
            .|......||     .|..::|          ..|.||...:.:.:...|       :.:...||
  Fly    69 ELYDRQPSMPTFADLFGQPSYESVLQEPEVASTSSSTNTNAAGIRSTDDGKFTNIPATMLSDQFG 133

  Fly   263 MLGLAKKLRSINQNP----LLFGNNV-AHNIGGAADS----IFTGPIQEARLTPQEMSYKLPLNY 318
            ::||...:|:...:|    |:||.:: .:.:..||..    .|.||:  .|..|...|....|  
  Fly   134 IIGLLAAMRTTQTDPGATQLVFGEDLTTYGLDLAAQGDIYVHFNGPL--TREPPDRNSMDCAL-- 194

  Fly   319 LFNVNMSLQEPKIEEMHDELL 339
                     |..:..|.|.::
  Fly   195 ---------EMGMRAMRDSII 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15262NP_609750.1 NOT2_3_5 294..414 CDD:282064 10/50 (20%)
CG6576NP_648253.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5601
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.