DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15262 and Not3

Sequence 1:NP_609750.1 Gene:CG15262 FlyBaseID:FBgn0028852 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001260712.1 Gene:Not3 FlyBaseID:FBgn0033029 Length:844 Species:Drosophila melanogaster

Alignment Length:536 Identity:104/537 (19%)
Similarity:159/537 (30%) Gaps:202/537 (38%)


  Fly     7 NTGDDQQEVESSPSPP---PPPPFQS----PLSSPESLQTPDGYPILYVDVVKNKPKQELPPSAS 64
            |...:...::..|.|.   .|.|.::    ||||...:..       .|....:|.:|:||.:||
  Fly   350 NKSSESNALKLKPQPHQLIKPTPVRATAKLPLSSDTQVNK-------IVSSTPSKNQQQLPTAAS 407

  Fly    65 --PSQPLAPEFSIFREDFPALPGSLPSALPT-ALPTTSSPVVPDDWTAMMSNS-----EQVELAK 121
              .:..:..:.||         ||..|...| |..:.||...|.:..|:..|:     ..:..|.
  Fly   408 IVATSAMQSQSSI---------GSCSSTGGTGASQSASSGNNPGNNPAVQPNAPTPGQSGIAAAA 463

  Fly   122 FRNTVIRNSSDPCVNANGNEVLRQPT----HAPEKRQNMELLPHMYGYLGNPFRLNLSMIFTKQF 182
            ....|:..:.....|..|..|: |||    .|...:.|..||.:      .|             
  Fly   464 ASTNVVSATIVSSANVQGQSVI-QPTPTIAFAAVAKHNTSLLEN------GP------------- 508

  Fly   183 LLEGVRQRAINAAHKRAALAKPAIQP-----PPGFENCKIFARLITNS----DGMPLGGVT---- 234
                |.|:.:......||:.....|.     ||       .:.|.|||    :|:|:...|    
  Fly   509 ----VLQQQLAVTPTVAAIVGAGTQAQQKHVPP-------LSNLQTNSPHIQNGLPVSDSTNDNS 562

  Fly   235 ---------------------FELGSPTNETTSNVEAKPSGSTIQGAFGMLGLAKKLRSINQNPL 278
                                 .:..|...:.||:::.:..    |....:|.......:.||..|
  Fly   563 CNVVDTISLKTMAQDAINRSAIDPNSLNQQQTSSIDLRQP----QSQKSLLQHFNSETNTNQQQL 623

  Fly   279 -------LFGNNVA---------------HNIGGAADSIFTGPIQEARLTPQEMS---------- 311
                   |..|::|               .|:..|.....:|..:.....||:|:          
  Fly   624 TSQQQQQLQNNSLAATTGSNNGTSTGSGLMNVANATGQPISGNAKTHACQPQQMATTEAHIPTLL 688

  Fly   312 -------------------------YKLP-------LNYLFNVNMSLQEPKIEEMH--------- 335
                                     |.||       |...|:     :.|.:...|         
  Fly   689 GVTPLGPTPLQKEHQMQFQMMEAAYYHLPQPMDTEKLQTYFH-----RAPVLTPSHYPQAQMPIY 748

  Fly   336 ----------DELLFFFFYTYAGDMMQMLAAAELAERGWRYHKYEHFWVIRQAD----NPNYLYH 386
                      .|.|||.||...|...|.|||..|.::.||:|.....|..|..:    |.:|   
  Fly   749 DTVEFYQRLSTETLFFVFYYMEGSKAQYLAAKALKKQSWRFHTKYMMWFQRHEEPKIINDDY--- 810

  Fly   387 GFREFGEYNYFNMWQW 402
               |.|.|.||:..:|
  Fly   811 ---EQGTYIYFDYEKW 823

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15262NP_609750.1 NOT2_3_5 294..414 CDD:282064 36/175 (21%)
Not3NP_001260712.1 Not3 3..233 CDD:281986
DUF3682 428..>509 CDD:289231 20/105 (19%)
NOT2_3_5 711..836 CDD:282064 32/125 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113217359
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23326
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.