DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15262 and Cnot2

Sequence 1:NP_609750.1 Gene:CG15262 FlyBaseID:FBgn0028852 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_006241425.1 Gene:Cnot2 RGDID:1311672 Length:550 Species:Rattus norvegicus

Alignment Length:449 Identity:99/450 (22%)
Similarity:164/450 (36%) Gaps:174/450 (39%)


  Fly    11 DQQEVESSPSPPPPPPFQSPLSSPESLQTPDGYPILYVDVVKNKPKQELPPSASPSQPLAPEFSI 75
            |:...|.|.:|       :||.:|.:.:.|      ||.:|           ..|:...:.:|||
  Rat   245 DRNRREGSGNP-------TPLINPLAGRAP------YVGMV-----------TKPANEQSQDFSI 285

  Fly    76 FREDFPALPGS-----------LPSALPTALPTTSS---PVVPDDWTAMMSNSEQVELAKFRNTV 126
            ..|||||||||           ..|.|.|:..||||   |..|.|.::...|:.|          
  Rat   286 HNEDFPALPGSSYKDPTSSNDDSKSNLSTSGKTTSSTDGPKFPGDKSSTTQNNNQ---------- 340

  Fly   127 IRNSSDPCVNANGNEVLRQPTHAPEKRQNMELLPHMYGYLGNPFRLNLSMIFTKQFLLEGVRQRA 191
                                     :::.:::||                        :|     
  Rat   341 -------------------------QKKGIQVLP------------------------DG----- 351

  Fly   192 INAAHKRAALAKPAIQPPPGFENCKIFARLITNSDGMPLGGVTFELGSPTNETTSNVEAKPSGST 256
                                         .:||   :|.|.||.:                    
  Rat   352 -----------------------------RVTN---IPQGMVTDQ-------------------- 364

  Fly   257 IQGAFGMLGLAKKLRSINQNP----LLFGNNVAHNIG---GAADSI---FTGPIQEARLTPQEMS 311
                |||:||...:|:...:|    |..|:::. .:|   .:.:::   |..|...:...||::.
  Rat   365 ----FGMIGLLTFIRAAETDPGMVHLALGSDLT-TLGLNLNSPENLYPKFASPWASSPCRPQDID 424

  Fly   312 YKLPLNYLFNVNM--SLQEPKIEEMHDELLFFFFYTYAGDMMQMLAAAELAERGWRYHKYEHFWV 374
            :.:|..||.|:::  .|...|:....::|||:.:|...||::|:|||.||..|.|||||.|..|:
  Rat   425 FHVPSEYLTNIHIRDKLAAIKLGRYGEDLLFYLYYMNGGDVLQLLAAVELFNRDWRYHKEERVWI 489

  Fly   375 IRQADNPNYLYHGFREFGEYNYFNMWQWKILPRHFYLDPEILERTLSKEELYVTYGYHP 433
            .|.......:.....|.|.|.:|:...|:.:.:.|:|:.:.||   .:..|..|:.|:|
  Rat   490 TRAPGMEPTMKTNTYERGTYYFFDCLNWRKVAKEFHLEYDKLE---ERPHLPSTFNYNP 545

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15262NP_609750.1 NOT2_3_5 294..414 CDD:282064 38/125 (30%)
Cnot2XP_006241425.1 NOT2_3_5 406..529 CDD:309328 38/123 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C224949502
eggNOG 1 0.900 E1_COG5601
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1273874at2759
OrthoFinder 1 1.000 FOG0003118
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23326
Phylome 1 0.910 0.750 Consistency score
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.