DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15262 and not2

Sequence 1:NP_609750.1 Gene:CG15262 FlyBaseID:FBgn0028852 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_587823.2 Gene:not2 PomBaseID:SPCC4G3.15c Length:306 Species:Schizosaccharomyces pombe

Alignment Length:141 Identity:46/142 (32%)
Similarity:61/142 (43%) Gaps:29/142 (20%)


  Fly   299 PIQEARL-------------TPQEMS---YKLPLNYLFNVNMSLQEPKIEEMHDELLFFFFYTYA 347
            |::|.||             |.:.:|   :|||..|. |||......||.:..||.||:.|||..
pombe   164 PVEEDRLISTNLFSPWAELNTKKPVSQPMFKLPACYK-NVNPPPAISKIFQFSDETLFYIFYTMP 227

  Fly   348 GDMMQMLAAAELAERGWRYHKYEHFWVIRQAD------NPNYLYHGFREFGEYNYFNMWQWKILP 406
            .|:||..||.||..|.||:||....|:.....      .|.:      |.|.|.:|:...||.:.
pombe   228 RDVMQEAAAQELTNRNWRFHKELRVWLTPVPGMKPLQRTPQF------ERGYYMFFDPIHWKRIK 286

  Fly   407 RHFYLDPEILE 417
            :.|.|....||
pombe   287 KDFLLMYAALE 297

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15262NP_609750.1 NOT2_3_5 294..414 CDD:282064 44/137 (32%)
not2NP_587823.2 CDC36 131..297 CDD:227888 45/140 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003118
OrthoInspector 1 1.000 T631624
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23326
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2209
TreeFam 00.000 Not matched by this tool.
44.130

Return to query results.
Submit another query.