DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15262 and ntl-2

DIOPT Version :8

Sequence 1:NP_609750.1 Gene:CG15262 / 34901 FlyBaseID:FBgn0028852 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_494772.1 Gene:ntl-2 / 173773 WormBaseID:WBGene00003825 Length:444 Species:Caenorhabditis elegans

Alignment Length:399 Identity:88/400 (22%)
Similarity:148/400 (37%) Gaps:140/400 (35%)


  Fly    48 VDVVKNKPKQELPPSASP-------SQP--LAPEFSIFREDFPALPGSLPSALPTALPTTSSPVV 103
            ::|.::.|.::|..:..|       |.|  ..|||.|..||||||||       .....|...::
 Worm    64 LNVAQSSPSRDLYGAQRPNYANLMRSDPSLTNPEFQIQNEDFPALPG-------VGSGQTQRSML 121

  Fly   104 PDDWTAMMSNSEQVELAKFRNTVIRNSSDPCVNANGNEVLRQPTHAPEKRQNMELLPHMYGYLG- 167
            .|....|:::..||:.|                                           |.|| 
 Worm   122 GDQLANMLADDHQVDFA-------------------------------------------GPLGD 143

  Fly   168 -NPFRLNLSMIFTKQFLLEGVRQRAINAAHKRAALAKPAIQPPPGFENCKIFARLITNSDGMPLG 231
             :|.||:            |:.:                                  ||...|:.
 Worm   144 CDPSRLS------------GISR----------------------------------NSQEGPMH 162

  Fly   232 GVTFELGSPTNETTSNVEAKPSGSTIQGAFGMLGLAKKLRSINQNPLLFGNNVAHNIGGAADSI- 295
            |:   :..|..|.| |:.|    |.:...|||.||...||::: ||.:....:.:::.....:: 
 Worm   163 GI---ITHPDGEVT-NIPA----SMLDDQFGMAGLVTYLRTVD-NPSIVSLALGYDLTTLGLNLN 218

  Fly   296 ---------FTGPIQEARLTPQEMSYKLPLNYLF--NVNMSLQEPKIEEMHDELLFFFFYTYAGD 349
                     |.||..::.:...|:..|:|..|:.  ::...|...::.::.:::||:.||....:
 Worm   219 LSERKLYMNFGGPWADSPIRAHELDVKVPEEYMTHNHIRDKLPPLRLNKVSEDVLFYLFYNCPNE 283

  Fly   350 MMQMLAAAELAERGWRYHKYEHFWVIR------QADNPNYLYHGFREFGEYNYFNMWQWKILPRH 408
            :.|:.||.||..|.||:||.|..|:.|      :....||      |.|.||.|:..||:.:|:.
 Worm   284 IYQVAAACELYAREWRFHKSEQVWLTRSQYGGVKEQTGNY------EKGHYNVFDQMQWRKIPKE 342

  Fly   409 FYLDPEILE 417
            ..|:.:.||
 Worm   343 LKLEYKELE 351

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15262NP_609750.1 NOT2_3_5 294..414 CDD:282064 36/138 (26%)
ntl-2NP_494772.1 NOT2_3_5 228..348 CDD:282064 36/126 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C224934583
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S2523
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1273874at2759
OrthoFinder 1 1.000 FOG0003118
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23326
Phylome 1 0.910 0.833 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2209
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.