DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15262 and cnot2

Sequence 1:NP_609750.1 Gene:CG15262 FlyBaseID:FBgn0028852 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001106600.1 Gene:cnot2 XenbaseID:XB-GENE-991720 Length:522 Species:Xenopus tropicalis

Alignment Length:435 Identity:103/436 (24%)
Similarity:168/436 (39%) Gaps:146/436 (33%)


  Fly    11 DQQEVESSPSPPPPPPFQSPLSSPESLQTPDGYPILYVDVVKNKPKQELPPSASPSQPLAPEFSI 75
            |:...|.|.:|       :||.:|.:.:.|      ||.:|..       |::..||    :|||
 Frog   217 DRNRREGSGNP-------TPLINPLAGRAP------YVGMVTK-------PASEQSQ----DFSI 257

  Fly    76 FREDFPALPGSLPSALPTALPTTSSPVVPDDWTAMMSNSEQVELAKFRNTVIRNSSDPCVNANGN 140
            ..|||||||||....     ||:|:    ||     |.|              |.:.|..:|:..
 Frog   258 HNEDFPALPGSSYKD-----PTSSN----DD-----SKS--------------NLNTPGKSASST 294

  Fly   141 EVLRQPTHAPEKRQNMELLPHMYGYLGNPFRLNLSMIFTKQFLLEGVRQRAINAAHKRAALAKPA 205
            :..:.|.......||           .|..:..:.::                            
 Frog   295 DGPKFPGDKSSTTQN-----------NNQQKKGIQVL---------------------------- 320

  Fly   206 IQPPPGFENCKIFARLITNSDGMPLGGVTFELGSPTNETTSNVEAKPSGSTIQGAFGMLGLAKKL 270
               |.|         .:||   :|.|.||.:                        |||:||...:
 Frog   321 ---PDG---------RVTN---IPQGMVTDQ------------------------FGMIGLLTFI 346

  Fly   271 RSINQNP----LLFGNNVAHNIG---GAADSI---FTGPIQEARLTPQEMSYKLPLNYLFNVNM- 324
            |:...:|    |..||::. .:|   .:.:::   |..|...:...||::.:.:|..||.|::: 
 Frog   347 RAAETDPGMVHLALGNDLT-TLGLNLNSPENLYPKFASPWASSPCRPQDIDFHVPSEYLTNIHIR 410

  Fly   325 -SLQEPKIEEMHDELLFFFFYTYAGDMMQMLAAAELAERGWRYHKYEHFWVIRQADNPNYLYHGF 388
             .|...|:....::|||:.:|...||::|:|||.||..|.|||||.|..|:.|.......:....
 Frog   411 DKLAAIKLGRYGEDLLFYLYYMNGGDVLQLLAAVELFNRDWRYHKEERVWITRAPGMEPTMKTNT 475

  Fly   389 REFGEYNYFNMWQWKILPRHFYLDPEILERTLSKEELYVTYGYHP 433
            .|.|.|.:|:...|:.:.:.|:|:.:.||   .:.:|..|:.|:|
 Frog   476 YERGTYYFFDCLNWRKVAKEFHLEYDKLE---ERPQLPSTFNYNP 517

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15262NP_609750.1 NOT2_3_5 294..414 CDD:282064 38/125 (30%)
cnot2NP_001106600.1 NOT2_3_5 378..501 CDD:282064 38/123 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C224953782
eggNOG 1 0.900 E1_COG5601
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1273874at2759
OrthoFinder 1 1.000 FOG0003118
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.710

Return to query results.
Submit another query.