DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uxt and uxt

Sequence 1:NP_001260464.1 Gene:Uxt FlyBaseID:FBgn0259982 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001004671.1 Gene:uxt ZFINID:ZDB-GENE-040912-118 Length:155 Species:Danio rerio

Alignment Length:130 Identity:46/131 (35%)
Similarity:77/131 (59%) Gaps:2/131 (2%)


  Fly    23 RITQIEEFINEVLKEDLRE-LEKCIGQYNEEIMEYVQLKNTLQTFDTHLPDGYKTQVNIGSNVFM 86
            ::.|.|.||:|||:.||:: ||:....| |:|.:|:|||||:|:.........||.|::|.|.::
Zfish    11 KVLQYETFISEVLRRDLQKVLEQRDAVY-EKIAQYLQLKNTIQSIQESGSKELKTDVDLGCNFYV 74

  Fly    87 QARVRKMDSILVDVGKNVFLDMSIPDAERFCDTRVKILTKQSDVLRDESVKKRAQIKMALIAISE 151
            ||.|.....|.|.||...|::.:..:|.:|.:.:...||:.::||..::.|.:|.|:|.|..:.|
Zfish    75 QAHVPDASRIYVAVGYGFFVEFTHAEALKFIEKKTNQLTEYTEVLTKDAAKIKANIRMVLEGLRE 139

  Fly   152  151
            Zfish   140  139

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UxtNP_001260464.1 Prefoldin_alpha 26..154 CDD:238327 46/128 (36%)
uxtNP_001004671.1 Prefoldin_alpha 13..142 CDD:238327 46/129 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3047
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5150
OMA 1 1.010
OrthoDB 1 1.010 D1559312at2759
OrthoFinder 1 1.000 FOG0006103
OrthoInspector 1 1.000 T1053559
orthoMCL 1 0.900 OOG5_129956
Panther 1 1.100 LDO PTHR13345
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5483
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.