DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uxt and F35H10.6

Sequence 1:NP_001260464.1 Gene:Uxt FlyBaseID:FBgn0259982 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_501397.2 Gene:F35H10.6 WormBaseID:WBGene00018071 Length:158 Species:Caenorhabditis elegans

Alignment Length:128 Identity:30/129 (23%)
Similarity:59/129 (46%) Gaps:0/129 (0%)


  Fly    19 ANKARITQIEEFINEVLKEDLRELEKCIGQYNEEIMEYVQLKNTLQTFDTHLPDGYKTQVNIGSN 83
            |.:..:..:|:....|:...:...||...:..::..||.:||.|.|......|...:.:..:|..
 Worm     7 AQERYMKYLEDLSENVIHPKIATEEKEFKKLQKQCEEYAKLKFTCQRLLNEAPKTTEGKTELGQR 71

  Fly    84 VFMQARVRKMDSILVDVGKNVFLDMSIPDAERFCDTRVKILTKQSDVLRDESVKKRAQIKMAL 146
            |||...||....::|.:..:|:::|.:.||.:.||.::..|....:.|:..:.|.:..:.|.|
 Worm    72 VFMNIEVRDTKHVVVKLCDDVYVEMKLQDAIKTCDRKMDSLKNMMEKLQKSTNKLKTDLTMLL 134

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UxtNP_001260464.1 Prefoldin_alpha 26..154 CDD:238327 29/122 (24%)
F35H10.6NP_501397.2 Prefoldin_alpha 15..141 CDD:238327 29/121 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3047
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I4052
Isobase 1 0.950 0 Normalized mean entropy S6280
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006103
OrthoInspector 1 1.000 T476890
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.