DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pol32 and Pold3

Sequence 1:NP_001188816.1 Gene:Pol32 FlyBaseID:FBgn0283467 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001355309.1 Gene:Pold3 MGIID:1915217 Length:462 Species:Mus musculus

Alignment Length:496 Identity:117/497 (24%)
Similarity:195/497 (39%) Gaps:114/497 (23%)


  Fly     7 LDDCMIDFDRCVLVTDLLEEYK-LSY------KEVNDVLEAYI---KEQEPATKFEKRFLVHGKR 61
            :|:.:.|.::.|       .|| |||      .:...:|..|:   :::....:....:||.|..
Mouse    10 IDEFVTDQNKIV-------TYKWLSYTLGVHVNQAKQMLYEYVERKRKENSGAQLHVTYLVSGSL 67

  Fly    62 KTQGSDSGEDLYSVVLESRMQDWLAKVQ-DAESQLYSVKIAGGTKAPAAIFKPMQHLEVKLAKVE 125
            ...|....:  .:||.|.:::...:|:. .|...:||::     ||......|:.:.:..:.| .
Mouse    68 IQNGHSCHK--VAVVREDKLEAVKSKLAVTASIHVYSIQ-----KAMLKDSGPLFNTDYDILK-S 124

  Fly   126 QRPGAGKI--------VPSANGTTPHNGVKSEPTKSEPSKSAVKLEPSKSSLKSE----PA-KSK 177
            ......|.        ||.|...:|.:      .|.|.|......|...|.|.:.    || |..
Mouse   125 NLQNCSKFSAIQCAAAVPRAPAESPSS------RKYEQSNLQAASEAQASELTTNGHGPPASKQA 183

  Fly   178 AEKP----------VASKSSPEDKKTSPKEQ----ASKAKPAAAKKGSI-NSFFTAAASKPKDVK 227
            :::|          .|:|:...:|:|.|:.:    ||.|...|..|||: ::||..||.....| 
Mouse   184 SQQPKGIMGMLISKAATKTQDTNKETKPEAREVTSASSAGGKAPGKGSVMSNFFGKAAMNKLKV- 247

  Fly   228 ATPSKSTSGTVDNFFKKQPAGAKKS---PPESEDKSKKDASNSNKKEASKKKSPSPT--KKPTTA 287
                        |...:|....:|:   ||.|..:.|..|..:.|| :|:|..|...  |:.::.
Mouse   248 ------------NLDSEQAVKEEKTVEQPPVSVTEPKLAAPPAQKK-SSRKSEPGKVQQKEKSSR 299

  Fly   288 NTSMQLFDEESAESSDEEEKLDMLRRKVIESDNDSDQ--------EKASSSKRRRISDSED---- 340
            ...:.|.|||:.|:  |..|....|.|:.:||:..|:        .:|.|.....:|...|    
Mouse   300 GKRVDLSDEEAKET--EHLKKKRRRIKLPQSDSSEDEVFEDSPEMYEADSPSPPPVSPPPDPMPK 362

  Fly   341 EEQPPKKSADEETIALDEKMDTEPANETYLDEDGFVITQR-----------KPTKAQPANKKVSP 394
            .|.||.|.:..||   ..:......::|::||:|.::|::           :..|.:||:....|
Mouse   363 TEPPPVKRSSGET---KRRRKRVLKSKTFVDEEGCIVTEKVYESESCTDSEEELKMKPASAHKPP 424

  Fly   395 KAAA---PVNKKKSPPSAAKA-GKDAPKTKQAGIMNFFSKK 431
            .||.   |..::|.|...|.| ||   ..:|..|..||.||
Mouse   425 AAAVKREPREERKGPKKGAAALGK---ANRQVSITGFFQKK 462

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pol32NP_001188816.1 CDC27 <153..431 CDD:286580 85/330 (26%)
Pold3NP_001355309.1 Interaction with PCNA. {ECO:0000250|UniProtKB:Q15054} 452..462 5/10 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28HEU
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130668
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.