| Sequence 1: | NP_001188816.1 | Gene: | Pol32 / 34892 | FlyBaseID: | FBgn0283467 | Length: | 431 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001355309.1 | Gene: | Pold3 / 67967 | MGIID: | 1915217 | Length: | 462 | Species: | Mus musculus |
| Alignment Length: | 496 | Identity: | 117/496 - (23%) |
|---|---|---|---|
| Similarity: | 195/496 - (39%) | Gaps: | 114/496 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 7 LDDCMIDFDRCVLVTDLLEEYK-LSY------KEVNDVLEAYI---KEQEPATKFEKRFLVHGKR 61
Fly 62 KTQGSDSGEDLYSVVLESRMQDWLAKVQ-DAESQLYSVKIAGGTKAPAAIFKPMQHLEVKLAKVE 125
Fly 126 QRPGAGKI--------VPSANGTTPHNGVKSEPTKSEPSKSAVKLEPSKSSLKSE----PA-KSK 177
Fly 178 AEKP----------VASKSSPEDKKTSPKEQ----ASKAKPAAAKKGSI-NSFFTAAASKPKDVK 227
Fly 228 ATPSKSTSGTVDNFFKKQPAGAKKS---PPESEDKSKKDASNSNKKEASKKKSPSPT--KKPTTA 287
Fly 288 NTSMQLFDEESAESSDEEEKLDMLRRKVIESDNDSDQ--------EKASSSKRRRISDSED---- 340
Fly 341 EEQPPKKSADEETIALDEKMDTEPANETYLDEDGFVITQR-----------KPTKAQPANKKVSP 394
Fly 395 KAAA---PVNKKKSPPSAAKA-GKDAPKTKQAGIMNFFSKK 431 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Pol32 | NP_001188816.1 | CDC27 | <153..431 | CDD:370537 | 84/329 (26%) |
| Pold3 | NP_001355309.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 144..186 | 11/47 (23%) | |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 200..230 | 8/29 (28%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 254..384 | 34/135 (25%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 403..462 | 17/61 (28%) | |||
| PIP-box. /evidence=ECO:0000250|UniProtKB:Q15054 | 452..459 | 2/6 (33%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_28HEU | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||