DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pol32 and Pold3

Sequence 1:NP_001188816.1 Gene:Pol32 FlyBaseID:FBgn0283467 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001019921.1 Gene:Pold3 RGDID:1312027 Length:462 Species:Rattus norvegicus

Alignment Length:500 Identity:113/500 (23%)
Similarity:192/500 (38%) Gaps:122/500 (24%)


  Fly     7 LDDCMIDFDRCVLVTDLLEEYK-LSY------KEVNDVLEAYI---KEQEPATKFEKRFLVHGKR 61
            :|:.:.|.::.|       .|| |||      .:...:|..|:   :::....:....:||.|..
  Rat    10 IDEFVTDQNKIV-------TYKWLSYTLGVHVNQAKQMLYEYVERKRKENSGAQLHVTYLVSGSL 67

  Fly    62 KTQGSDSGEDLYSVVLESRMQDWLAKVQ-DAESQLYSVKIAGGTKAPAAIFKPMQHLEVKLAKVE 125
            ...|....:  .:||.|.|::...:|:. .|...:||::     ||......|:.:.:..:.|  
  Rat    68 IQNGHSCHK--VAVVREDRLEAVKSKLAVTASIHVYSIQ-----KAMLKDSGPLFNTDYDILK-- 123

  Fly   126 QRPGAGKIVPSANGTTPHNGVK---SEPTKSEPSKSAVKLEPSKSSLKSEPAKSK----AEKPVA 183
                     .:....:..:.::   :.|.....|.|:.|.|.|.....||...|:    ...|.|
  Rat   124 ---------SNLQNCSKFSAIQCAAAVPRAPAESSSSRKFEQSNLQAASETQASELTTNGHGPPA 179

  Fly   184 SKSSPE----------------------DKKTSPKE--QASKAKPAAAKKGSI--NSFFTAAASK 222
            ||.:.:                      |.||..:|  .||.|...|..||::  |.|..||.||
  Rat   180 SKQASQQPKGIMGMLISKAATKTQDTNKDTKTEAREVTSASSAGGKAPGKGNVMSNFFGKAAMSK 244

  Fly   223 PK-DVKATPSKSTSGTVDNFFKKQPAGAKKSPPESEDKSKKDASNSNKKEASKKKSP--SPTKKP 284
            .| ::.:..:.....||:            .||.|..:.|..|..:.|| :|:|..|  ...|:.
  Rat   245 LKVNLDSEQAVKEEKTVE------------QPPVSVAEPKLAAPPALKK-SSRKSEPVKMQQKEK 296

  Fly   285 TTANTSMQLFDEESAESSDEEEKLDMLRRKVIESDNDSDQEKASSSKR-RRISDSEDEEQPP--- 345
            ......:.|.|||:.|:.:.::|  ..|.|:.:||:..|:..|.|.:. ..:|.|.....||   
  Rat   297 KCRGKRVDLSDEEAKETENLKKK--RRRIKLPQSDSSEDEVFADSPEMFEAVSPSPPPASPPPDP 359

  Fly   346 ---------KKSADEETIALDEKMDTEPANETYLDEDGFVITQR-----------KPTKAQPANK 390
                     |:|:.|.    ..|......::|::||:|.::|::           :.||.:.|:.
  Rat   360 VPKTEPPPVKRSSGEN----KRKRKRVLKSKTFVDEEGCMVTEKVYESESCTDSEEETKMKMASA 420

  Fly   391 KVSPKAAA---PVNKKKSPPSAAKA-GKDAPKTKQAGIMNFFSKK 431
            :..|.|..   |..::|.|...|.| ||   ..:|..|..||.||
  Rat   421 QRPPAATVKREPREERKGPKKGAAALGK---ANRQVSITGFFQKK 462

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pol32NP_001188816.1 CDC27 <153..431 CDD:286580 85/339 (25%)
Pold3NP_001019921.1 CDC27 19..462 CDD:286580 110/490 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28HEU
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130668
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.