DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pol32 and cdc27

DIOPT Version :9

Sequence 1:NP_001188816.1 Gene:Pol32 / 34892 FlyBaseID:FBgn0283467 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_595419.1 Gene:cdc27 / 2539627 PomBaseID:SPBC1734.02c Length:372 Species:Schizosaccharomyces pombe


Alignment Length:481 Identity:101/481 - (20%)
Similarity:162/481 - (33%) Gaps:166/481 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLKKALDDCMIDFDRCVLVTDL----LEEYKLSYKEVNDVLEAYIKEQEPATKFEKRFLVHGKR 61
            :.:|...:..::..|...|..|:    .:||...:.:.||.|...             :|:||: 
pombe     8 LDIKVINESSLVTVDNLSLQLDISSEKAQEYLNMFYQGNDFLYPI-------------YLIHGQ- 58

  Fly    62 KTQGSDSGEDLYSVVLESRMQDWLAKVQDAESQLYSVKIAGGTKAPAAIFKPMQHLEVKLAKVEQ 126
                              .:.|.:....|.|||            |.:.|..:|::....:.:::
pombe    59 ------------------PIDDEINLEIDEESQ------------PISNFPVLQYILCDKSSLQE 93

  Fly   127 RPGAGKIVPSANGTTPHNGVKSE--PTKSEPSKSAVKLEPSKSSLKSEPAKSKAEKPVASKSSPE 189
            :....|           :|.|:.  ...|.|.....:|.|:...::        ||.|..|    
pombe    94 KQSRLK-----------SGYKTVIFALSSAPLSDFDELLPAVYEIR--------EKDVLYK---- 135

  Fly   190 DKKTSPKEQASK--------AKPAAAKKG-SINSFFTAAASKPKDVKATPSKSTSGT--VDNFFK 243
                  ||.|.|        :.|...||. |.:|...:..||...:..|.::||..|  .|.|  
pombe   136 ------KEDADKYGFIFNENSVPRVLKKAPSTHSPQLSVPSKTSTIDKTDTRSTEKTKGKDIF-- 192

  Fly   244 KQPAGAKKSPPESEDKSKK-DASNSNKKE----ASKKKSPSPTKKPTTANTSMQLFDEESAESS- 302
               :.|:.....|..|:|| ...|..:||    ..:|.|....::.......|||.||..:.:| 
pombe   193 ---SNARNQKGNSSRKNKKAPLENHKEKEPLLPKEEKLSEQAKRERDDLKNIMQLEDESVSTTSV 254

  Fly   303 --DEEEKLDMLRRKVIESDN--------------DSDQE---KASSSKRR------RISDSEDEE 342
              .|::.||        |:|              |..||   ..|..|||      :.:.::|||
pombe   255 HDSEDDNLD--------SNNFQLEIGTEAKSAAPDEPQEIIKSVSGGKRRGKRKVKKYATTKDEE 311

  Fly   343 --QPPKKSADEETIALDEKMDTEPANETYLDEDGFVITQRKPTKAQPANKKVSPKAAAPVNKKKS 405
              ...|:....|:.:.||.:.|..:|          :.:.|||....|.||        .|..:|
pombe   312 GFLVTKEEEVWESFSEDENISTGTSN----------VVRNKPTTVNIATKK--------KNTAQS 358

  Fly   406 PPSAAKAGKDAPKTKQAGIMNFFSKK 431
            .|            :|..||:||.||
pombe   359 KP------------QQKSIMSFFGKK 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pol32NP_001188816.1 CDC27 <153..431 CDD:370537 76/321 (24%)
cdc27NP_595419.1 CDC27 <157..372 CDD:286580 62/257 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28HEU
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.