DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dao and SmydA-7

Sequence 1:NP_001260462.1 Gene:dao FlyBaseID:FBgn0028862 Length:882 Species:Drosophila melanogaster
Sequence 2:NP_001261039.1 Gene:SmydA-7 FlyBaseID:FBgn0034182 Length:488 Species:Drosophila melanogaster

Alignment Length:600 Identity:111/600 (19%)
Similarity:182/600 (30%) Gaps:207/600 (35%)


  Fly   331 AVAKNALIFESEAVAMVPSGNCRVCDYCGITQFIPFPCIYCSNRLVVYCSRQCRFKHAAIHAVEC 395
            |:.....|.|...:.:.|...|.           ...|..|.....|.| |:|:....   .::|
  Fly    25 AIEPGDTILEERPLLVAPHWECH-----------QLKCAQCLQESYVIC-RRCQVFPL---CMDC 74

  Fly   396 FGH---QIELFES-FGEV---------FGMPRLLQLAFRMLITGLPELLGHCR---KKPTLSKLW 444
            ..|   :.|.|.| .|:.         ||:..||:|   :|:...|...|.|:   ..|.....:
  Fly    75 NQHDEFECEFFTSGAGKALCKDILVKNFGICGLLKL---LLLLENPRTKGDCQMLIDVPINLSDY 136

  Fly   445 SAINGGLQERQDIAYSAVLRLERLKEERPTDTVIALALAAHILSIYLSKCTTFFDQLEKSLPTAS 509
            ....|..||.:::....::. ..|.:..||..:.:.||.||.:                      
  Fly   137 RDGEGMWQEHEELVVRPLME-SGLADVLPTQELTSDALHAHCI---------------------- 178

  Fly   510 RMSSAEWELLCAALLMRHIGQLRHRSLTACRSFVLPADPHVFSPLNEFQLWAAPMRLQEGHLHLL 574
            |:.|..:|                  :||.....|..   :|       :|.|            
  Fly   179 RIDSNSFE------------------VTAKDGDTLKG---IF-------VWGA------------ 203

  Fly   575 AGEVAVVSYSVYPDTLNLCRHSCSSTICAKFSGRTVTALALLDLPAGSGIYNCFAGGNFQQLPRE 639
                            .|..|...:|:.|......:...|.:.|..|..|||.:..   ..:...
  Fly   204 ----------------TLPHHCVPNTVVALDEQFNMKLYAAVPLQPGDIIYNSYTN---PLMGTS 249

  Fly   640 ERTKQL-LESGIRCHCNAC-----QLTHSD---------------DQFHKFHRYRCDNPNCMEIF 683
            :|..|| |...:.|.|:.|     ..||..               |...|...:||  |:|..:.
  Fly   250 QRQHQLRLSRRLECICSRCLDPTEMGTHMSSLKCKECPGFSVCEIDSNGKLGDWRC--PDCRALL 312

  Fly   684 TPNALPHAPSLRWWLSEEYTQPEFNGADLIMCPHCGEYQKLEWFWAFTTS-----------LIDC 737
            |             .:|.:......|:.|:  ...|:.|..|   |..|.           |:|.
  Fly   313 T-------------AAEVHELQAAVGSALV--DAMGDLQVYE---ALLTQYGPLLHPNHFMLLDI 359

  Fly   738 ELIEERCKLYAAIERAENQLMDLHE-CKVALARLLLEQCLMVHREGATVLDDWEFNKLGSILRSV 801
            :      :..|:|.||...:..:.: ||..||| .:|.|                :.|..:.|:|
  Fly   360 K------QNIASILRAAALMNSMDQPCKKLLAR-RVELC----------------SDLLPVCRAV 401

  Fly   802 LPSVMAQYGGQSIEYVKYFSYFWDVMAL-----SNYKCNDRELMQMLNALEFIADEFKDIF---- 857
            :|.:...|.      :..|.|...::.|     :....:.:|.:..|.....:|.|..|:.    
  Fly   402 VPGISKLYA------IGLFEYLLALVELVELQFAESDLSKKEYVAHLRTASLVATEAMDLLRFEP 460

  Fly   858 INYYEDYIAPKFAEE 872
            .|..|.|:|.:.:.|
  Fly   461 ENSAEGYLADRISME 475

Known Domains:


GeneSequenceDomainRegion External IDIdentity
daoNP_001260462.1 TPR_11 165..235 CDD:290150
TPR repeat 200..235 CDD:276809
TPR repeat 243..270 CDD:276809
zf-MYND 355..395 CDD:280009 6/40 (15%)
SmydA-7NP_001261039.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56387928
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.