DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dao and Smyd2

Sequence 1:NP_001260462.1 Gene:dao FlyBaseID:FBgn0028862 Length:882 Species:Drosophila melanogaster
Sequence 2:NP_996733.1 Gene:Smyd2 RGDID:727785 Length:433 Species:Rattus norvegicus

Alignment Length:544 Identity:97/545 (18%)
Similarity:179/545 (33%) Gaps:195/545 (36%)


  Fly   337 LIFESEAVAMVPSGNCR--VCDYC-----GITQFIPFPCIYCSNRLVVYCSRQCRFKHAAIHAVE 394
            |:|...|.|.|.:...|  .|:.|     |:::     |..|  :...||..:|:.:...:|.:|
  Rat    32 LLFSCPAYACVLTVGERGHHCECCFARKEGLSK-----CGRC--KQAFYCDVECQKEDWPLHKLE 89

  Fly   395 CFGHQIELFESFGEVFGMPRLLQLAFRMLITGLPELLGHCRKKPTLSKLWSAINGGLQERQDIAY 459
            |....:     |||.:.....::|..|                                      
  Rat    90 CSSMVV-----FGENWNPSETVRLTAR-------------------------------------- 111

  Fly   460 SAVLRLERLKEER-PTDTVIALALAAHILSIYLSKCTTFFDQLEKSLPTASRMSSAEWELLCAAL 523
              :|..:::..|| |::.:    ||......:|.|    .|..:|.|..:.          .|||
  Rat   112 --ILAKQKMHPERTPSEKL----LAVREFESHLDK----LDNEKKDLIQSD----------IAAL 156

  Fly   524 ---LMRHIGQLRHRSLTA------CRSFVLPADPHVFSPLNEFQLWAAPMRLQEGHLHLLAGEVA 579
               ..:|:....|.||..      |..|.:..:                             |::
  Rat   157 HQFYSKHLEFPDHSSLVVLFAQVNCNGFTIEDE-----------------------------ELS 192

  Fly   580 VVSYSVYPDTLNLCRHSCSSTICAKFSGRTVTALALLDLPAGSGIYNCFAGGNFQQLPREERTKQ 644
            .:..:::|| :.|..|||...:...:.|......|:.::..|..::..:....:   |.|:|..:
  Rat   193 HLGSAIFPD-VALMNHSCCPNVIVTYKGTLAEVRAVQEIHPGDEVFTSYIDLLY---PTEDRNDR 253

  Fly   645 LLES-GIRCHCNACQLTHSDDQFHKFHRYRCDNPNCMEIFTPNALPHAPSLRWWLSEEYTQPEFN 708
            |.:| ...|.|..|  |..|....|....:..||           |.|.::|             
  Rat   254 LRDSYFFTCECREC--TTKDKDKAKVEIRKLSNP-----------PQAEAIR------------- 292

  Fly   709 GADLIMCPH--CGEYQKLEWFWAFTTSLIDCELIEERCKLYAAIERAENQLMDLHECKVALARLL 771
              |::....  ..|:::.:.:.:.:..|..|||.:|  |:.:..|  ::.:..||....|:.   
  Rat   293 --DMVRYARNVIEEFRRAKHYKSPSELLEICELSQE--KMSSVFE--DSNVYMLHMMYQAMG--- 348

  Fly   772 LEQCLMVHREGATVLDDWEFNKLGSILRSVLPSVMAQYGGQSIE-YVKYFSYF-------W---- 824
              .||        .:.|||    |::          :||.:.|: |.|::..:       |    
  Rat   349 --VCL--------YMQDWE----GAL----------KYGQKIIKPYSKHYPVYSLNVASMWLKLG 389

  Fly   825 -DVMALSNYKCNDRELMQMLNALE 847
             ..|.|.|....::.|.:.:..:|
  Rat   390 RLYMGLENKAAGEKALKKAIAIME 413

Known Domains:


GeneSequenceDomainRegion External IDIdentity
daoNP_001260462.1 TPR_11 165..235 CDD:290150
TPR repeat 200..235 CDD:276809
TPR repeat 243..270 CDD:276809
zf-MYND 355..395 CDD:280009 10/45 (22%)
Smyd2NP_996733.1 S-adenosyl-L-methionine binding. {ECO:0000250} 17..19
zf-MYND 52..90 CDD:280009 10/45 (22%)
Peptide substrate binding. {ECO:0000250} 183..185 1/2 (50%)
SET <204..240 CDD:279228 7/36 (19%)
S-adenosyl-L-methionine binding. {ECO:0000250} 206..207 0/1 (0%)
S-adenosyl-L-methionine binding. {ECO:0000250} 258..260 0/2 (0%)
TPR_12 338..413 CDD:290160 19/102 (19%)
TPR_10 381..422 CDD:290111 6/34 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56431321
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.