DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dao and Smyd4

Sequence 1:NP_001260462.1 Gene:dao FlyBaseID:FBgn0028862 Length:882 Species:Drosophila melanogaster
Sequence 2:NP_001099280.1 Gene:Smyd4 RGDID:1307369 Length:801 Species:Rattus norvegicus

Alignment Length:756 Identity:157/757 (21%)
Similarity:254/757 (34%) Gaps:201/757 (27%)


  Fly   170 REAGNDSYRKERHPLKASDLFTEAIFLAPAR-NTLAAALAHANRSLVLFDCGLYAESYDDCLCAL 233
            ||.||..: :|:..:.|:.|:::.:  :.:| ||...:|.:||||..||..|.:.....|.:.|.
  Rat    72 REEGNKRF-QEKEYMGAAVLYSKGV--SHSRPNTEDISLCYANRSAALFHLGQHEACLKDIVRAG 133

  Fly   234 DLGYPEEYLPLIKLRQAACALKLRNFALCEEHLHELLHIELNQVFEARTHELWHQCEVLKVERFE 298
            ..||||...|.:.:|:..|   |.|....:|....:..:|.:...:.......||.....|::.:
  Rat   134 MHGYPERLQPKLMIRKTEC---LVNLGRLQEARQTISDLENSLTTKPTLMPSSHQILQRNVQQLK 195

  Fly   299 MAVQTGDDLDIND----SKAFE----------IAWLDNSSSLHT----------TRAVAKNALIF 339
            |.:|..:.|..:.    :||.|          |:....|.||.|          |:.:....|:.
  Rat   196 MKIQEKETLPESFPAALTKALEDMALGEENKQISGASLSVSLCTDPLKGRHLVATKDILPGELLV 260

  Fly   340 ESEAVA-------MVPSGNC-------RV------CDYCGITQFIPFPCIYCSNRLVVYCSRQC- 383
            :.:|..       |.|..:|       ||      |..|........||..||  ...|||::| 
  Rat   261 KEDAFVSVLNPGEMPPLRHCLENKWDTRVTSADLYCHRCLRHTLATVPCGGCS--YAKYCSQECV 323

  Fly   384 --RFKHAAIHAVEC-----------FGH---QIELFESFGEVFGMPRLLQLAFRMLITGLPELLG 432
              .:.|  .|:.||           |.|   ::.|...|.:|..:.|::........|.|||   
  Rat   324 QQAWDH--YHSTECSLGGLLLTLGVFCHVALRMTLLARFEDVDRVIRMICDKTGRKDTCLPE--- 383

  Fly   433 HCRKKPTLSKLWSAINGGLQERQDIAYSAVLRLERLKEERPTDTVIALALAAHILSIYLSKCTTF 497
                ...|.|.:...|.|..|...         |..:...|...|             ..|....
  Rat   384 ----SKDLVKTFGYTNQGESEENS---------ETCEPSIPGCNV-------------NGKYENN 422

  Fly   498 FDQLEKSLPTASRMSSAEWELLCAALLMRHIGQLRHRSLTACRSFVLPADPHVFSP--LNEFQLW 560
            :|.:...||...: .|.|.:.:||..:.....||:..||.|..:.:........:|  ..:..:|
  Rat   423 YDAVLSLLPHTEK-HSPEHKFICAVSVSALCRQLKATSLQAQTTGLKSPRLKAVTPGLCTDLTVW 486

  Fly   561 AAPMRLQEGHLHLLAGEVAVVSYS------------------VYPDTLNLCRHSCSSTICAKFSG 607
            ...|......|...|..:..:.|:                  |:| .::|..||||......|:.
  Rat   487 GVAMLQHMLQLQCNAQAITSICYAGSKESIITNSRQVRLATGVFP-VVSLLNHSCSPNTSVSFTS 550

  Fly   608 RTVTALALLDLPAGSGIYNCFAGGNFQQLPREER-----TKQLLESG--IRCHCNACQLTHSDDQ 665
            ...|..|...:..|..|.:|:.       |.|.|     .:|.|.|.  ..|.|.||   |::  
  Rat   551 TVATIRAAQQIAKGQEILHCYG-------PHESRMGVAERQQRLSSQYFFDCSCPAC---HAE-- 603

  Fly   666 FHKFHRYRCDNPNCMEIFTPNALPHAPSLRWWLSEEY----TQPEFNGADLIMCPH--CGEYQKL 724
                                 .|..|.:.||   |.:    .:....|.|::.|.:  |      
  Rat   604 ---------------------TLRAAVAPRW---EAFCCNTCRVPMQGNDVLSCSNESC------ 638

  Fly   725 EWFWAFTTSLIDCELIEERCKLYAAI---------ERAENQLMDLHECKVALARLLLEQCLMVHR 780
                  |.|:....|:.....|...:         :|.|..:..|.||:.|....|..:..::..
  Rat   639 ------TNSVSRDRLVSRLQDLQQQVHTAQKLLRSDRPEQAIQQLLECQRAAENFLSAEHTVLGE 697

  Fly   781 ------EGATVLDDWEFNKLGSILRSVLPSVMAQYGGQSIE 815
                  :....|.||  .:..:.::..|..|.|::|..|:|
  Rat   698 IEDGLAQAYATLGDW--RQSAAHVQKSLQVVEARHGPSSVE 736

Known Domains:


GeneSequenceDomainRegion External IDIdentity
daoNP_001260462.1 TPR_11 165..235 CDD:290150 20/66 (30%)
TPR repeat 200..235 CDD:276809 13/36 (36%)
TPR repeat 243..270 CDD:276809 6/27 (22%)
zf-MYND 355..395 CDD:280009 13/43 (30%)
Smyd4NP_001099280.1 TPR_11 68..132 CDD:290150 19/63 (30%)
TPR repeat 68..96 CDD:276809 7/27 (26%)
TPR repeat 101..136 CDD:276809 12/35 (34%)
zf-MYND 296..335 CDD:280009 13/43 (30%)
SET <526..572 CDD:279228 13/47 (28%)
TPR_12 692..>748 CDD:290160 9/48 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56191304
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1278034at2759
OrthoFinder 1 1.000 FOG0002920
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46165
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.