DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dao and Smyd2

Sequence 1:NP_001260462.1 Gene:dao FlyBaseID:FBgn0028862 Length:882 Species:Drosophila melanogaster
Sequence 2:NP_081072.1 Gene:Smyd2 MGIID:1915889 Length:433 Species:Mus musculus

Alignment Length:548 Identity:95/549 (17%)
Similarity:176/549 (32%) Gaps:203/549 (37%)


  Fly   337 LIFESEAVAMVPSGNCR--VCDYC-----GITQFIPFPCIYCSNRLVVYCSRQCRFKHAAIHAVE 394
            |:|...|.|.|.:...|  .|:.|     |:::     |..|  :...||..:|:.:...:|.:|
Mouse    32 LLFSCPAYACVLTVGERGHHCECCFARKEGLSK-----CGRC--KQAFYCDVECQKEDWPLHKLE 89

  Fly   395 CFGHQIELFESFGEVFGMPRLLQLAFRMLI--------TGLPELLGHCRKKPTLSKLWSAINGGL 451
            |....:     .||.:.....::|..|:|.        |...:||.....:..|.||.:      
Mouse    90 CSSMVV-----LGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVREFESHLDKLDN------ 143

  Fly   452 QERQDIAYSAVLRLERLKEERPTDTVIALALAAHILSIYLSKCTTFFDQLEKSLPTASRMSSAEW 516
             |::|:..|.:..|.:                      :.||...|.|                 
Mouse   144 -EKKDLIQSDIAALHQ----------------------FYSKYLEFPD----------------- 168

  Fly   517 ELLCAALLMRHIGQLRHRSLTA------CRSFVLPADPHVFSPLNEFQLWAAPMRLQEGHLHLLA 575
                            |.||..      |..|.:..:                            
Mouse   169 ----------------HSSLVVLFAQVNCNGFTIEDE---------------------------- 189

  Fly   576 GEVAVVSYSVYPDTLNLCRHSCSSTICAKFSGRTVTALALLDLPAGSGIYNCFAGGNFQQLPREE 640
             |::.:..:::|| :.|..|||...:...:.|......|:.::..|..::..:....:   |.|:
Mouse   190 -ELSHLGSAIFPD-VALMNHSCCPNVIVTYKGTLAEVRAVQEIHPGDEVFTSYIDLLY---PTED 249

  Fly   641 RTKQLLES-GIRCHCNACQLTHSDDQFHKFHRYRCDNPNCMEIFTPNALPHAPSLRWWLSEEYTQ 704
            |..:|.:| ...|.|..|  |..|....|....:..:|           |.|.::|         
Mouse   250 RNDRLRDSYFFTCECREC--TTKDKDKAKVEVRKLSSP-----------PQAEAIR--------- 292

  Fly   705 PEFNGADLIMCPH--CGEYQKLEWFWAFTTSLIDCELIEERCKLYAAIERAENQLMDLHECKVAL 767
                  |::....  ..|:::.:.:.:.:..|..|||.:|  |:.:..|  ::.:..||....|:
Mouse   293 ------DMVRYARNVIEEFRRAKHYKSPSELLEICELSQE--KMSSVFE--DSNVYMLHMMYQAM 347

  Fly   768 ARLLLEQCLMVHREGATVLDDWEFNKLGSILRSVLPSVMAQYGGQSIE-YVKYFSYF-------W 824
            .     .||        .:.|||    |::          :||.:.|: |.|::..:       |
Mouse   348 G-----VCL--------YMQDWE----GAL----------KYGQKIIKPYSKHYPVYSLNVASMW 385

  Fly   825 -----DVMALSNYKCNDRELMQMLNALE 847
                 ..|.|.|....::.|.:.:..:|
Mouse   386 LKLGRLYMGLENKAAGEKALKKAIAIME 413

Known Domains:


GeneSequenceDomainRegion External IDIdentity
daoNP_001260462.1 TPR_11 165..235 CDD:290150
TPR repeat 200..235 CDD:276809
TPR repeat 243..270 CDD:276809
zf-MYND 355..395 CDD:280009 10/45 (22%)
Smyd2NP_081072.1 S-adenosyl-L-methionine binding. {ECO:0000250} 17..19
zf-MYND 52..90 CDD:307734 10/45 (22%)
SET <157..240 CDD:307139 19/168 (11%)
Peptide substrate binding. {ECO:0000250} 183..185 1/2 (50%)
S-adenosyl-L-methionine binding. {ECO:0000250} 206..207 0/1 (0%)
S-adenosyl-L-methionine binding. {ECO:0000250} 258..260 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56428826
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.