DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4168 and fmodb

DIOPT Version :10

Sequence 1:NP_609740.4 Gene:CG4168 / 34889 FlyBaseID:FBgn0028888 Length:1330 Species:Drosophila melanogaster
Sequence 2:XP_005167298.1 Gene:fmodb / 797559 ZFINID:ZDB-GENE-080327-28 Length:362 Species:Danio rerio


Alignment Length:332 Identity:90/332 - (27%)
Similarity:136/332 - (40%) Gaps:96/332 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   423 RLTTVPVALSSLHHLKYLYLTSNQISQL-----NNLPSFT----------------------ENL 460
            :|..||...|   |:||:||.:|||:.:     :|.|:.|                      .||
Zfish    82 KLQHVPFVPS---HIKYVYLQNNQITGITNGVFDNAPNLTWIIMHANKLTSDKIGDKVFAKLPNL 143

  Fly   461 RVLSLSGNNFSMIPVLGLKNYTQLSYLNMGYNSITDIPEGIFAVDSWGSNLQTILLRNNKITHLH 525
            :.|.|..||.|.:|                    .|:|.          :|:.:.|.:|.|:.:.
Zfish   144 QRLFLQNNNLSRVP--------------------QDLPH----------SLRDLHLNHNNISVVP 178

  Fly   526 LGSFAGLEQIQEISLSFNDITIHHPLVFENVSRTLKILELSFAVFPARSLESLDPLDALLP--LS 588
            |.||.|:..:..:.|..|.|        |::...||.| ||..|...|. ..|..:...||  ||
Zfish   179 LNSFHGMSNLTALYLQANAI--------EDLGNALKGL-LSLTVLDLRG-NRLKMIPQSLPPKLS 233

  Fly   589 QLIWLGLDNNNLKQVSNESFAQMRELSYINLSFNQLKT--LPRGLFQSDAHSHLVEIDLSYNGLE 651
            ||.   |:.|.:..:..:..:|..:|.::.||.|||..  :|...|..   |.|||:|||:|.||
Zfish   234 QLY---LEYNYISSIPADFLSQRPDLRFVRLSHNQLTNGGIPANAFNV---STLVELDLSFNKLE 292

  Fly   652 RLEAQTFHSLGDLQTLNLQSNRLRTIARHAF------HNLEFLRYLDLSYNRLVNISHGAFTVLP 710
            |:...:    ..|:.|.||:|:::..:..:|      :|...||.|.|..|.:....      :|
Zfish   293 RIPTIS----TSLENLYLQANKIKEFSVSSFCRVVDTNNYSNLRVLRLEANEITPRD------IP 347

  Fly   711 NLAALDL 717
            |.|.|.|
Zfish   348 NEAVLCL 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4168NP_609740.4 PRK15370 <69..>353 CDD:185268
leucine-rich repeat 99..118 CDD:275380
leucine-rich repeat 122..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..194 CDD:275380
leucine-rich repeat 195..214 CDD:275380
leucine-rich repeat 215..236 CDD:275380
leucine-rich repeat 266..287 CDD:275380
leucine-rich repeat 288..311 CDD:275380
leucine-rich repeat 312..338 CDD:275380
LRR <338..651 CDD:443914 70/258 (27%)
leucine-rich repeat 339..365 CDD:275380
leucine-rich repeat 366..388 CDD:275380
leucine-rich repeat 389..412 CDD:275380
leucine-rich repeat 414..436 CDD:275380 4/12 (33%)
leucine-rich repeat 437..459 CDD:275380 10/48 (21%)
leucine-rich repeat 460..483 CDD:275380 7/22 (32%)
leucine-rich repeat 484..510 CDD:275380 2/25 (8%)
leucine-rich repeat 511..534 CDD:275380 8/22 (36%)
leucine-rich repeat 535..589 CDD:275380 15/55 (27%)
LRR 543..971 CDD:443914 56/185 (30%)
leucine-rich repeat 590..613 CDD:275380 4/22 (18%)
leucine-rich repeat 614..639 CDD:275380 8/26 (31%)
leucine-rich repeat 640..663 CDD:275380 10/22 (45%)
leucine-rich repeat 664..687 CDD:275380 7/28 (25%)
leucine-rich repeat 688..711 CDD:275380 5/22 (23%)
leucine-rich repeat 712..735 CDD:275380 3/6 (50%)
leucine-rich repeat 740..783 CDD:275380
leucine-rich repeat 785..808 CDD:275380
leucine-rich repeat 809..832 CDD:275380
leucine-rich repeat 833..856 CDD:275380
leucine-rich repeat 857..879 CDD:275380
leucine-rich repeat 880..900 CDD:275380
leucine-rich repeat 905..928 CDD:275380
LRR 911..>1203 CDD:443914
leucine-rich repeat 929..952 CDD:275380
leucine-rich repeat 953..977 CDD:275380
leucine-rich repeat 978..1020 CDD:275380
leucine-rich repeat 1045..1068 CDD:275380
leucine-rich repeat 1069..1090 CDD:275380
leucine-rich repeat 1091..1114 CDD:275380
leucine-rich repeat 1115..1161 CDD:275380
leucine-rich repeat 1162..1190 CDD:275380
PCC 1230..>1298 CDD:188093
fmodbXP_005167298.1 LRRNT 61..95 CDD:214470 5/15 (33%)
LRR_8 91..153 CDD:404697 17/64 (27%)
leucine-rich repeat 94..116 CDD:275380 8/21 (38%)
leucine-rich repeat 117..142 CDD:275380 1/24 (4%)
LRR <137..361 CDD:443914 75/274 (27%)
leucine-rich repeat 143..163 CDD:275380 9/49 (18%)
leucine-rich repeat 164..187 CDD:275380 8/22 (36%)
leucine-rich repeat 188..210 CDD:275380 7/30 (23%)
leucine-rich repeat 211..231 CDD:275380 5/20 (25%)
leucine-rich repeat 232..255 CDD:275380 7/25 (28%)
leucine-rich repeat 256..280 CDD:275380 8/26 (31%)
leucine-rich repeat 281..300 CDD:275380 10/22 (45%)
leucine-rich repeat 301..321 CDD:275380 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.