DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4168 and Lrrtm4

DIOPT Version :10

Sequence 1:NP_609740.4 Gene:CG4168 / 34889 FlyBaseID:FBgn0028888 Length:1330 Species:Drosophila melanogaster
Sequence 2:XP_017448300.1 Gene:Lrrtm4 / 500219 RGDID:1560707 Length:591 Species:Rattus norvegicus


Alignment Length:353 Identity:97/353 - (27%)
Similarity:146/353 - (41%) Gaps:94/353 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   492 NSITDIPEGIFAVDSWGSNLQTILLRNNKITHLHLGSFAGLEQIQEISLSFNDITIHHPLVFENV 556
            ::..||||.|    |.||  |.:.||.|.|..|....|||                         
  Rat    51 HAFADIPENI----SGGS--QGLSLRFNSIQKLKSNQFAG------------------------- 84

  Fly   557 SRTLKILELSFAVFPARSLESLDPLDALLPLSQLIWLGLDNNNLKQVSNESFAQMRELSYINLSF 621
                                          |:|||||.||:|.:..|..::|..:|.|..:.||.
  Rat    85 ------------------------------LNQLIWLYLDHNYISSVDEDAFQGIRRLKELILSS 119

  Fly   622 NQLKTLPRGLFQSDAH--SHLVEIDLSYNGLERLEAQTFHSLGDLQTLNLQSNRLRTIARHAFHN 684
            |::..|....|    |  .:|..:|||||.|:.|:::.|..|..|..|:|:||.|:|:....|.:
  Rat   120 NKITYLHNKTF----HPVPNLRNLDLSYNKLQTLQSEQFKGLRKLIILHLRSNSLKTVPIRVFQD 180

  Fly   685 LEFLRYLDLSYNRLVNISHGAFTVLPNLAALDLMHNQLCSLSLKSFLYVSNTTTPLRLNVSHNHI 749
            ...|.:|||.||||.::|..||..|..|..|.|.|||..                 ::|.:|   
  Rat   181 CRNLDFLDLGYNRLRSLSRNAFAGLLKLKELHLEHNQFS-----------------KINFAH--- 225

  Fly   750 ASFYDELSSYMYIYQLDISHNHV-TKSDSFTNLANTLRFLNLAHNQLGSLQSHAFGDLEFLEILN 813
               :..|.:...||   :..|.: :.|...|...::|..|:|:.|.:.:::...|..|..|:.||
  Rat   226 ---FPRLFNLRSIY---LQWNRIRSVSQGLTWTWSSLHTLDLSGNDIQAIEPGTFKCLPNLQKLN 284

  Fly   814 VAHNNLTSLRRRSFQGLNSLQELDLSHN 841
            :..|.||::.:.:.....||..:.||.|
  Rat   285 LDSNKLTNVSQETVNAWISLISITLSGN 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4168NP_609740.4 PRK15370 <69..>353 CDD:185268
leucine-rich repeat 99..118 CDD:275380
leucine-rich repeat 122..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..194 CDD:275380
leucine-rich repeat 195..214 CDD:275380
leucine-rich repeat 215..236 CDD:275380
leucine-rich repeat 266..287 CDD:275380
leucine-rich repeat 288..311 CDD:275380
leucine-rich repeat 312..338 CDD:275380
LRR <338..651 CDD:443914 42/160 (26%)
leucine-rich repeat 339..365 CDD:275380
leucine-rich repeat 366..388 CDD:275380
leucine-rich repeat 389..412 CDD:275380
leucine-rich repeat 414..436 CDD:275380
leucine-rich repeat 437..459 CDD:275380
leucine-rich repeat 460..483 CDD:275380
leucine-rich repeat 484..510 CDD:275380 7/17 (41%)
leucine-rich repeat 511..534 CDD:275380 9/22 (41%)
leucine-rich repeat 535..589 CDD:275380 1/53 (2%)
LRR 543..971 CDD:443914 80/302 (26%)
leucine-rich repeat 590..613 CDD:275380 9/22 (41%)
leucine-rich repeat 614..639 CDD:275380 7/26 (27%)
leucine-rich repeat 640..663 CDD:275380 10/22 (45%)
leucine-rich repeat 664..687 CDD:275380 8/22 (36%)
leucine-rich repeat 688..711 CDD:275380 12/22 (55%)
leucine-rich repeat 712..735 CDD:275380 6/22 (27%)
leucine-rich repeat 740..783 CDD:275380 8/43 (19%)
leucine-rich repeat 785..808 CDD:275380 6/22 (27%)
leucine-rich repeat 809..832 CDD:275380 6/22 (27%)
leucine-rich repeat 833..856 CDD:275380 4/9 (44%)
leucine-rich repeat 857..879 CDD:275380
leucine-rich repeat 880..900 CDD:275380
leucine-rich repeat 905..928 CDD:275380
LRR 911..>1203 CDD:443914
leucine-rich repeat 929..952 CDD:275380
leucine-rich repeat 953..977 CDD:275380
leucine-rich repeat 978..1020 CDD:275380
leucine-rich repeat 1045..1068 CDD:275380
leucine-rich repeat 1069..1090 CDD:275380
leucine-rich repeat 1091..1114 CDD:275380
leucine-rich repeat 1115..1161 CDD:275380
leucine-rich repeat 1162..1190 CDD:275380
PCC 1230..>1298 CDD:188093
Lrrtm4XP_017448300.1 leucine-rich repeat 44..62 CDD:275380 5/14 (36%)
leucine-rich repeat 65..87 CDD:275380 10/76 (13%)
LRR 67..>312 CDD:443914 87/329 (26%)
leucine-rich repeat 88..111 CDD:275380 9/22 (41%)
leucine-rich repeat 112..135 CDD:275380 7/26 (27%)
leucine-rich repeat 136..159 CDD:275380 10/22 (45%)
leucine-rich repeat 160..183 CDD:275380 8/22 (36%)
leucine-rich repeat 184..207 CDD:275380 12/22 (55%)
leucine-rich repeat 208..231 CDD:275380 9/45 (20%)
leucine-rich repeat 232..255 CDD:275380 5/25 (20%)
leucine-rich repeat 256..279 CDD:275380 6/22 (27%)
leucine-rich repeat 304..316 CDD:275378 4/9 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.