DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4168 and OMD

DIOPT Version :10

Sequence 1:NP_609740.4 Gene:CG4168 / 34889 FlyBaseID:FBgn0028888 Length:1330 Species:Drosophila melanogaster
Sequence 2:NP_005005.1 Gene:OMD / 4958 HGNCID:8134 Length:421 Species:Homo sapiens


Alignment Length:379 Identity:91/379 - (24%)
Similarity:153/379 - (40%) Gaps:111/379 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   664 LQTLNLQSNRLRTIARHAFHNLEFLRYLDLSYNRLVN--ISHGAFTVLPNLAALDLMHNQLCSLS 726
            :|.|.||.|.:..:..::|.|...|:.::||:|::.:  |.:|.|..||||              
Human    93 IQQLYLQFNEIEAVTANSFINATHLKEINLSHNKIKSQKIDYGVFAKLPNL-------------- 143

  Fly   727 LKSFLYVSNTTTPLRLNVSHNHIASFYDELSSYMYIYQLDISHNHVTKSDSFTNLANTLRFLNLA 791
                         |:|::.||::..|                        .|. |..:|..|.|.
Human   144 -------------LQLHLEHNNLEEF------------------------PFP-LPKSLERLLLG 170

  Fly   792 HNQLGSLQSHAFGDLEFLEILNVAHNNLTSLRRRSFQGLNSLQELDLSHNQL-DQLQVEQ-FSNL 854
            :|::..||::|                        ..||.:|..|||.:|.| |.|..:: |:.:
Human   171 YNEISKLQTNA------------------------MDGLVNLTMLDLCYNYLHDSLLKDKIFAKM 211

  Fly   855 RKLRILRINSNRLRALPREVFMNTRLEFLDIAENQLSVWPVPAFTDIGFTLRSIQMSHNNLEYLD 919
            .||..|.:.||||.::|..  :.:.|.:|.:..|.:|..|...|..:. .|.:::||||.|:.:.
Human   212 EKLMQLNLCSNRLESMPPG--LPSSLMYLSLENNSISSIPEKYFDKLP-KLHTLRMSHNKLQDIP 273

  Fly   920 ASMFINSQFLYDISLARNRITILPDNTFSFLNNLTNLDLSQNPLVTTNLREVFVHTPRLRKLSLH 984
            .::| |...:.::|:..|::    ...|....||.:|.|..|.:...||.   |..|.:..|..|
Human   274 YNIF-NLPNIVELSVGHNKL----KQAFYIPRNLEHLYLQNNEIEKMNLT---VMCPSIDPLHYH 330

  Fly   985 HMGLYVLPPLKLPLLSYLDVSGNYLQELSPLGS-----LRHLRHVNVSHNKLTN 1033
            |             |:|:.|..|.|:|  |:.|     ..|:..:.....:.||
Human   331 H-------------LTYIRVDQNKLKE--PISSYIFFCFPHIHTIYYGEQRSTN 369

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG4168NP_609740.4 PRK15370 <69..>353 CDD:185268
leucine-rich repeat 99..118 CDD:275380
leucine-rich repeat 122..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..194 CDD:275380
leucine-rich repeat 195..214 CDD:275380
leucine-rich repeat 215..236 CDD:275380
leucine-rich repeat 266..287 CDD:275380
leucine-rich repeat 288..311 CDD:275380
leucine-rich repeat 312..338 CDD:275380
LRR <338..651 CDD:443914
leucine-rich repeat 339..365 CDD:275380
leucine-rich repeat 366..388 CDD:275380
leucine-rich repeat 389..412 CDD:275380
leucine-rich repeat 414..436 CDD:275380
leucine-rich repeat 437..459 CDD:275380
leucine-rich repeat 460..483 CDD:275380
leucine-rich repeat 484..510 CDD:275380
leucine-rich repeat 511..534 CDD:275380
leucine-rich repeat 535..589 CDD:275380
LRR 543..971 CDD:443914 75/310 (24%)
leucine-rich repeat 590..613 CDD:275380
leucine-rich repeat 614..639 CDD:275380
leucine-rich repeat 640..663 CDD:275380
leucine-rich repeat 664..687 CDD:275380 7/22 (32%)
leucine-rich repeat 688..711 CDD:275380 8/24 (33%)
leucine-rich repeat 712..735 CDD:275380 1/22 (5%)
leucine-rich repeat 740..783 CDD:275380 7/42 (17%)
leucine-rich repeat 785..808 CDD:275380 7/22 (32%)
leucine-rich repeat 809..832 CDD:275380 2/22 (9%)
leucine-rich repeat 833..856 CDD:275380 9/24 (38%)
leucine-rich repeat 857..879 CDD:275380 7/21 (33%)
leucine-rich repeat 880..900 CDD:275380 6/19 (32%)
leucine-rich repeat 905..928 CDD:275380 8/22 (36%)
LRR 911..>1203 CDD:443914 32/128 (25%)
leucine-rich repeat 929..952 CDD:275380 3/22 (14%)
leucine-rich repeat 953..977 CDD:275380 7/23 (30%)
leucine-rich repeat 978..1020 CDD:275380 11/46 (24%)
leucine-rich repeat 1045..1068 CDD:275380
leucine-rich repeat 1069..1090 CDD:275380
leucine-rich repeat 1091..1114 CDD:275380
leucine-rich repeat 1115..1161 CDD:275380
leucine-rich repeat 1162..1190 CDD:275380
PCC 1230..>1298 CDD:188093