DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4168 and CG14762

DIOPT Version :10

Sequence 1:NP_609740.4 Gene:CG4168 / 34889 FlyBaseID:FBgn0028888 Length:1330 Species:Drosophila melanogaster
Sequence 2:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster


Alignment Length:440 Identity:122/440 - (27%)
Similarity:202/440 - (45%) Gaps:83/440 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 LNLEQNFVTQLPEAVFKATGIAHLVLAFNAISRVHPSAFEGLTETLEYLDLERNRLTTVP-VALS 432
            |.|..|.:.:|...||.|..|.||.:..::::.:..:|...|...|..||:..|::.||| .||.
  Fly    86 LKLRHNNLPKLQGFVFLALDIRHLTIHNSSLAAIEENALSSLGAGLTQLDVSLNQMKTVPSQALQ 150

  Fly   433 SLHHLKYLYLTSNQISQL-NNLPSFTENLRVLSLSGNNFSMI---PVLGLKNYTQLSYLNMGYNS 493
            .|.||..|.|..|:|:.: ||.....|.|.:|:|..|..:.|   ...||:::  :..||:|.|.
  Fly   151 HLFHLLILNLNHNKITVIHNNAFEGLETLEILTLYENKITQIDPEAFRGLEDH--IKRLNLGGND 213

  Fly   494 ITDIPEGIFAVDSWGSNLQTILLRNNKITHLHLGSFAGLEQIQEISLSFNDITIHHPLVFENVSR 558
            :|:||:...::   .|.|:.:.::.|||..:..|.|.||:.:..:.|:.|.||.....||.::: 
  Fly   214 LTNIPQKALSI---LSTLKKLEIQENKIRTISEGDFEGLQSLDSLILAHNMITTVPANVFSHLT- 274

  Fly   559 TLKILEL---SFAVFPARSLESLD----------------PLDALLPLSQLIWLGLDNNNLKQVS 604
            .|..|||   ..:|....:.:.|:                |.:||.||.:|..|.|.|||:..::
  Fly   275 LLNSLELEGNKISVIDKDAFKGLEENLQYLRLGDNQIHTIPSEALRPLHRLRHLDLRNNNINVLA 339

  Fly   605 NESFAQMRE-LSYINLSFNQLKTLPRGLFQSDAHSHLVEIDLSYNGLERLEAQTFHSLGDLQTLN 668
            .::|....: |:::||..|.:|.||..||:                          :|..|:|||
  Fly   340 EDAFTGFGDSLTFLNLQKNDIKVLPSLLFE--------------------------NLNSLETLN 378

  Fly   669 LQSNRLRTIARHAFHN-LEFLRYLDLSYNRLVNISHGAFTVLPNLAALDLMHNQ----------L 722
            ||:|:|:.|.:..... ::.||.:|::.|.| |.| ...|..|.|  |:.:.|:          |
  Fly   379 LQNNKLQRIPQDIMEPVIDTLRIIDITDNPL-NCS-CELTWFPKL--LEDLKNKDDEMSQKKKPL 439

  Fly   723 CSLSL--KSFLYVSNTTTPLR---LNVSHNHIASFYDELSSYMYIYQLDI 767
            |.:||  :.:...:..|..:.   ||||.:..:      ...|.|.|::|
  Fly   440 CHMSLDNREYFVQAMPTEKMHCAGLNVSPSPTS------GGLMRILQVNI 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4168NP_609740.4 PRK15370 <69..>353 CDD:185268
leucine-rich repeat 99..118 CDD:275380
leucine-rich repeat 122..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..194 CDD:275380
leucine-rich repeat 195..214 CDD:275380
leucine-rich repeat 215..236 CDD:275380
leucine-rich repeat 266..287 CDD:275380
leucine-rich repeat 288..311 CDD:275380
leucine-rich repeat 312..338 CDD:275380
LRR <338..651 CDD:443914 87/306 (28%)
leucine-rich repeat 339..365 CDD:275380
leucine-rich repeat 366..388 CDD:275380 7/18 (39%)
leucine-rich repeat 389..412 CDD:275380 5/22 (23%)
leucine-rich repeat 414..436 CDD:275380 10/22 (45%)
leucine-rich repeat 437..459 CDD:275380 7/22 (32%)
leucine-rich repeat 460..483 CDD:275380 7/25 (28%)
leucine-rich repeat 484..510 CDD:275380 7/25 (28%)
leucine-rich repeat 511..534 CDD:275380 8/22 (36%)
leucine-rich repeat 535..589 CDD:275380 17/72 (24%)
LRR 543..971 CDD:443914 67/261 (26%)
leucine-rich repeat 590..613 CDD:275380 7/22 (32%)
leucine-rich repeat 614..639 CDD:275380 9/24 (38%)
leucine-rich repeat 640..663 CDD:275380 1/22 (5%)
leucine-rich repeat 664..687 CDD:275380 9/23 (39%)
leucine-rich repeat 688..711 CDD:275380 8/22 (36%)
leucine-rich repeat 712..735 CDD:275380 7/34 (21%)
leucine-rich repeat 740..783 CDD:275380 8/31 (26%)
leucine-rich repeat 785..808 CDD:275380
leucine-rich repeat 809..832 CDD:275380
leucine-rich repeat 833..856 CDD:275380
leucine-rich repeat 857..879 CDD:275380
leucine-rich repeat 880..900 CDD:275380
leucine-rich repeat 905..928 CDD:275380
LRR 911..>1203 CDD:443914
leucine-rich repeat 929..952 CDD:275380
leucine-rich repeat 953..977 CDD:275380
leucine-rich repeat 978..1020 CDD:275380
leucine-rich repeat 1045..1068 CDD:275380
leucine-rich repeat 1069..1090 CDD:275380
leucine-rich repeat 1091..1114 CDD:275380
leucine-rich repeat 1115..1161 CDD:275380
leucine-rich repeat 1162..1190 CDD:275380
PCC 1230..>1298 CDD:188093
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380 7/18 (39%)
leucine-rich repeat 107..129 CDD:275380 4/21 (19%)
LRR <131..410 CDD:443914 90/311 (29%)
leucine-rich repeat 131..154 CDD:275380 10/22 (45%)
leucine-rich repeat 155..178 CDD:275380 7/22 (32%)
leucine-rich repeat 179..203 CDD:275380 7/23 (30%)
leucine-rich repeat 204..227 CDD:275380 7/25 (28%)
leucine-rich repeat 228..251 CDD:275380 8/22 (36%)
leucine-rich repeat 252..275 CDD:275380 6/23 (26%)
leucine-rich repeat 276..300 CDD:275380 6/23 (26%)
leucine-rich repeat 301..324 CDD:275380 5/22 (23%)
leucine-rich repeat 325..349 CDD:275380 7/23 (30%)
leucine-rich repeat 350..373 CDD:275380 10/48 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.