DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4168 and tsku

DIOPT Version :10

Sequence 1:NP_609740.4 Gene:CG4168 / 34889 FlyBaseID:FBgn0028888 Length:1330 Species:Drosophila melanogaster
Sequence 2:NP_956027.2 Gene:tsku / 325958 ZFINID:ZDB-GENE-030131-4683 Length:366 Species:Danio rerio


Alignment Length:320 Identity:89/320 - (27%)
Similarity:145/320 - (45%) Gaps:61/320 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   566 SFAVFPARSLESLD-----PLDALLPLSQLIWLGLDNNNLKQVSNESFAQMRELSYINLSFNQLK 625
            :|.:|.:.||..:|     |.:..:|:.      ||.                 |:::||.|.:.
Zfish    52 TFGLFDSFSLTKVDCSRIGPGNTPVPIP------LDT-----------------SHLDLSLNSIT 93

  Fly   626 TLPRGLFQSDAHSHLVEIDLSYNGLERLEAQTFHSLGDLQTLNLQSNRLRTIARHAFHNLEFLRY 690
            ::...:.....::.||.:|||                        ||.:..|:..||..|.:|..
Zfish    94 SISDTMLSGPGYTTLVSLDLS------------------------SNLIAQISPKAFSKLRYLET 134

  Fly   691 LDLSYNRLVNISHGAFTVLPNLAALDLMHNQLCSLSLKSFLYVSNT-TTPLRLNVSHNHIASFYD 754
            ||||.|.|..:|.|.||.|| |..|||..||....:|.  |:.:.| ..|:.:::|.|.:.|.:.
Zfish   135 LDLSSNALEGLSDGCFTGLP-LVELDLSENQFKEFNLD--LFTTRTQDLPIMVDLSRNLLTSIFR 196

  Fly   755 ELSSY-MYIYQLDISHNHVTKSDSFTNLANTLRFLNLAHNQLGSLQSHAFGDLEFLEILNVAH-N 817
            ....: :||..|.::.|.:........:  .|::|||..|.:.|:.:.||..|..|..|:::. :
Zfish   197 RTPGHPLYIKSLMLAGNQLKTVPKLNGI--PLQYLNLDGNLISSIDTGAFDSLTELVHLSLSGLS 259

  Fly   818 NLTSLRRRSFQGLNSLQELDLSHN-QLDQLQVEQFSNLRKLRILRINSNRLRALPREVFM 876
            .||.:...:|:.|.:||.||||:| ||..|..:.||.|..|:.|.:::..:..|.|.|||
Zfish   260 ELTLIHPGAFRSLKNLQALDLSNNSQLKTLNPDVFSGLVSLQELNLSNTAVTPLSRTVFM 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4168NP_609740.4 PRK15370 <69..>353 CDD:185268
leucine-rich repeat 99..118 CDD:275380
leucine-rich repeat 122..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..194 CDD:275380
leucine-rich repeat 195..214 CDD:275380
leucine-rich repeat 215..236 CDD:275380
leucine-rich repeat 266..287 CDD:275380
leucine-rich repeat 288..311 CDD:275380
leucine-rich repeat 312..338 CDD:275380
LRR <338..651 CDD:443914 18/89 (20%)
leucine-rich repeat 339..365 CDD:275380
leucine-rich repeat 366..388 CDD:275380
leucine-rich repeat 389..412 CDD:275380
leucine-rich repeat 414..436 CDD:275380
leucine-rich repeat 437..459 CDD:275380
leucine-rich repeat 460..483 CDD:275380
leucine-rich repeat 484..510 CDD:275380
leucine-rich repeat 511..534 CDD:275380
leucine-rich repeat 535..589 CDD:275380 7/27 (26%)
LRR 543..971 CDD:443914 89/320 (28%)
leucine-rich repeat 590..613 CDD:275380 2/22 (9%)
leucine-rich repeat 614..639 CDD:275380 4/24 (17%)
leucine-rich repeat 640..663 CDD:275380 5/22 (23%)
leucine-rich repeat 664..687 CDD:275380 6/22 (27%)
leucine-rich repeat 688..711 CDD:275380 12/22 (55%)
leucine-rich repeat 712..735 CDD:275380 8/22 (36%)
leucine-rich repeat 740..783 CDD:275380 7/43 (16%)
leucine-rich repeat 785..808 CDD:275380 9/22 (41%)
leucine-rich repeat 809..832 CDD:275380 6/23 (26%)
leucine-rich repeat 833..856 CDD:275380 13/23 (57%)
leucine-rich repeat 857..879 CDD:275380 7/20 (35%)
leucine-rich repeat 880..900 CDD:275380
leucine-rich repeat 905..928 CDD:275380
LRR 911..>1203 CDD:443914
leucine-rich repeat 929..952 CDD:275380
leucine-rich repeat 953..977 CDD:275380
leucine-rich repeat 978..1020 CDD:275380
leucine-rich repeat 1045..1068 CDD:275380
leucine-rich repeat 1069..1090 CDD:275380
leucine-rich repeat 1091..1114 CDD:275380
leucine-rich repeat 1115..1161 CDD:275380
leucine-rich repeat 1162..1190 CDD:275380
PCC 1230..>1298 CDD:188093
tskuNP_956027.2 leucine-rich repeat 82..107 CDD:275380 4/41 (10%)
LRR <106..>314 CDD:443914 71/236 (30%)
leucine-rich repeat 108..131 CDD:275380 11/46 (24%)
leucine-rich repeat 132..153 CDD:275380 11/20 (55%)
leucine-rich repeat 155..176 CDD:275380 8/22 (36%)
leucine-rich repeat 177..220 CDD:275380 9/42 (21%)
leucine-rich repeat 226..249 CDD:275380 9/22 (41%)
leucine-rich repeat 250..274 CDD:275380 6/23 (26%)
leucine-rich repeat 275..299 CDD:275380 13/23 (57%)
leucine-rich repeat 300..323 CDD:275380 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.